CAZyme Information: MGYG000001972_01539

Basic Information

• Species: Prevotella sp900315955
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900315955
• CAZyme ID: MGYG000001972_01539
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		37021.95	5.1034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001972	3441323	MAG	Denmark	Europe

• Gene Location: Start: 15275; End: 16258 Strand: +

Full Sequence      

MADNGVNTCFATNNAEILCQREDVDLVYICTDWESHADLVCCALANGKHVAVEVPAAMTV
KDCWKIVDLAEQQQLHCMMLENACYDYFEMATAAMAHAGKFGDIVHAAGGYHHWLNDRWE
PWRLRYNYANRGDIYPTHGLGPVCLALGIHRTDRIETLVSMDSAPVSGPDYYQRFCGENG
NGFRNGDVTTTLLRTRLGRTIVLDHDVMTPRPYSRLYQLVGTKGYAAKYPKETLWLDGRE
LTDNECKRVISEWLPADIREAKENAAKYDDRGGISFIMDSRLVDNLRQGKQMDMDVYDLA
EWCAVVELSRLSIEGGFVPVAFPDFRR

Enzyme Prediction     

No EC number prediction in MGYG000001972_01539.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	14	327	2.8e-114	0.8170426065162907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.37e-17	11	150	55	185	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.23e-09	22	79	61	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	1.02e-06	9	105	51	146	putative oxidoreductase; Provisional
PRK11579	PRK11579	0.002	23	123	64	164	putative oxidoreductase; Provisional
pfam03447	NAD_binding_3	0.002	4	72	39	108	Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB47378.1	3.71e-121	18	327	99	422
QUB78007.1	1.80e-112	18	325	99	420
ATA72461.1	9.98e-112	18	327	129	459
ATA74570.1	9.98e-112	18	327	129	459
ATA88384.1	1.50e-111	18	327	131	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	4.73e-58	25	327	115	435	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	5.95e-40	18	325	86	426	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	6.89e-09	16	167	58	197	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
4H3V_A	7.57e-08	18	168	70	216	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]
1EVJ_A	1.23e-06	13	134	59	182	ChainA, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_B Chain B, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_C Chain C, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_D Chain D, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MWF4	1.34e-111	18	327	123	453	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
Q89ZX8	2.09e-110	18	327	122	452	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	1.40e-107	18	327	119	449	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	1.40e-107	18	327	119	449	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
A6L1Z2	4.14e-106	16	327	130	470	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000094	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001972_01539.