CAZyme Information: MGYG000001973_00381

Basic Information

• Species: CAG-349 sp001940895
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-349; CAG-349 sp001940895
• CAZyme ID: MGYG000001973_00381
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808	MGYG000001973_2|CGC1	88628.84	6.5243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001973	1480786	MAG	Denmark	Europe

• Gene Location: Start: 159010; End: 161436 Strand: -

Full Sequence      

MEDVKTLIGKLTLEEKVSLLSGKTFWITYPVERLGIPSVKMTDGPHGTREEIEGGGVTNV
MKDSVPSTCFPSLVVYGSSWDRGLAYECAKSIGEEAATQGISTVLGPGTNIKRSPLCGRN
FEYFSEDPYLSGELASAFIDGLQSENVGASLKHYCANNQENSRMSIDTIVDERALREIYL
PAFETAIKRSKPWQVMCSYNRLNGEFLSENKHMINDVLRGEFGFDGMVVSDWGAINRRVP
GVDAGVDLEMPGNNGLNNQKIIDAVKDGTLSEEALDKAVENVLRYVEKGEKSLRKGYTCD
YDKHHETARKMAAAGAVLLKNDDSALPYDKKDKIAVIGALADKPRYQGGGSSQIHPKKLV
SILDALKAENVDFDYAEGYSLKGDGYDAKLLKKAVEVAKSHDKVIVVIGLTPEYESEGFD
RRHMDLPMGHNKLVDELAKVNENLVVVLVCGSPVTLPWTKRVKALLNIYVGGEAGGEAAV
DILFGKVNPSGKLAETFPKRLSDNINSAYFPMGTKNVQYRESVFVGYRYFDTAGKPVRYP
FGFGLSYTTFAYSDIKVSADKLTDNDVLSVSFDIENTGSVAGAEVAQVYVKDVKSTIFRP
EKELKGFEKVFLNPGEKKTVTVTLDKRAFAFYNVCVNDWTVESGEFEILVGASSRDIKLS
HTVAVTAPEVGIKDYRQDAPAYYDLANTTELPIEQFSAIYGKDVPENVAPKRGEFDVNST
VNEVAVTRLGKFLRSVLVFGAKLLTRGAANKTMAVNGIVTMPLRSFSSFTGGLVSETSVD
GLVDMLNKTKGGFKKFVKGFKKSQKPQR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	251	9.7e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.62e-102	4	658	38	758	beta-glucosidase BglX.
COG1472	BglX	1.49e-72	33	358	57	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.78e-68	5	625	54	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.31e-58	316	547	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.01e-39	33	284	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53344.1	1.96e-267	5	787	4	786
ALX08008.1	3.25e-267	3	787	4	752
ANV75754.1	3.25e-267	3	787	4	752
ADU74070.1	3.25e-267	3	787	4	752
ABN52488.1	3.25e-267	3	787	4	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.39e-268	3	787	4	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.78e-192	8	657	9	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.32e-156	1	665	1	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.06e-155	1	665	1	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.52e-131	3	657	5	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	6.51e-268	3	787	4	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.15e-193	8	665	9	672	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.21e-192	8	665	9	670	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	8.80e-144	4	658	46	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
A1CA51	2.35e-132	3	672	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001973_00381.