CAZyme Information: MGYG000001973_01327

Basic Information

• Species: CAG-349 sp001940895
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-349; CAG-349 sp001940895
• CAZyme ID: MGYG000001973_01327
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
873	MGYG000001973_12|CGC1	98962.77	6.5127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001973	1480786	MAG	Denmark	Europe

• Gene Location: Start: 32376; End: 34997 Strand: +

Full Sequence      

MKLDLTGKWLFKTGYDKEFSECVVPGTTICDMIAQNRIKNPLFNPFKGVSDDKDATFANL
GLTDFIYKKSFSVSEDFLKAKKIYLVSKCLDTLVLIYLNGREVTHHENAFIEFRDEVKEF
LVPGENVLEYRFCAPEGFARGAAKLVSTPKNFNGLTGIVHIRKPQYHFGWDFAPYLPVSG
IKDDVYLECGDVARISDFRITQKFNSDNSVTLSLVCTAENFSDNEIDAVFSVLSPDGTEY
GAAGVPVGNGEFKADIEIVNPELWQTHDRADKREQPLYEVIASLTSAGEIVDGRIEKTGL
RKITLDTAPDEYGKNFRIILNDVPLFAKGANYIPPDIVYTTDKKRITDTLDAVTFAGMNM
LRVFGGSVYPDDFFFEECDRRGILVWQDFMFACQGYPFFLPTFEENCKNEAVFQIKRLRN
HPSLALWCGNNEVEQMSIGWIAKSKYADSIGKYFYETLPALVRTYDDRDYTPGSPCGVDY
LFGFDADNTGDCHIWSVWHGLQPVSYYEKRLPRFASEFGMMSLPDEKTIDGFFEDNEKKV
VDAKSLKLRDRSHGGIRLIKYYSLSRFNIPRDLGGWIYASQLSVAESLYEAVSHFRRNKG
RVNGTLIWQMNDVWPGISWSLTDYFGRYKAALYALKRAYAPVAVNVKKTDGGFYVYVFND
TDKEISANLTFQVCNYDGKVLLEKVSGINAAPGENKLLFGKGMAAVRNQNKKLRCYALAK
MTVEGKEYTDTVLLRREKYAKLPSPEISESFEFISDGVLEIRLVSNVYAHGVRLINNIND
APFSDNWFDLIPGREKTVTVNLGRTCPIENIGEKITVSSCADLKTRGGAFAAFFRRLGIK
LVPLHFVNYIAAKRPPRDVKKKYVDFYSKEDEI

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	698	1.5e-83	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.94e-71	63	788	63	773	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.83e-12	96	432	97	417	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	1.19e-10	193	301	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	2.90e-10	745	822	2	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	1.53e-05	655	739	5	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG59052.1	5.51e-142	1	822	1	816
BBI32724.1	4.59e-141	3	822	4	821
ADL52891.1	3.57e-138	3	822	4	817
BAV13124.1	4.55e-138	3	822	13	826
AVQ95585.1	2.50e-135	3	827	4	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.07e-121	24	800	37	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.09e-121	24	800	37	832	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	7.62e-121	24	800	35	830	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	7.81e-121	24	800	37	832	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	3.26e-118	9	818	15	830	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D911	7.02e-90	5	800	9	828	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	7.02e-90	5	800	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1CGA8	7.02e-90	2	800	6	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
B0YBU9	2.59e-89	5	800	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q0CCA0	6.46e-88	9	800	13	826	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001973_01327.