CAZyme Information: MGYG000001975_02376

Basic Information

• Species: Prevotella sp900552515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552515
• CAZyme ID: MGYG000001975_02376
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		36794.57	8.4209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001975	2921145	MAG	Denmark	Europe

• Gene Location: Start: 97; End: 1068 Strand: +

Full Sequence      

MGFIPVLMHLPTIFRNMAKCKRDIVEWQPDALILVDYPGFNLDIAKYIHSYTQIPVYYYI
SPKIWAWKEWRIKSIKRDVDQLFSILPFEVPFFEQKHHYPIHYVGNPTAEEVRQFRESYT
ESADEFRRRHNLSSRPIIALLAGSRRQEIKDNLPAMIDAASRFADHQMVLACAPGIPFEY
YNQFVDGRGVQLVSDDTYALLSHARAAVVTSGTATLETALLNVPQAVCYKTPLPRLTALL
KRLVLKVRFVSLVNLIAGREVVRELVADTFSVDNIASELTRLLPDGDYRSQMLAGYGEVM
GKIGEDSPSKCTAHIIYGLVKKN

Enzyme Prediction     

No EC number prediction in MGYG000001975_02376.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	300	4.9e-95	0.8305084745762712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.76e-85	1	299	58	355	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.56e-83	1	322	58	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.38e-62	1	289	55	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.61e-53	1	310	62	376	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.70e-45	1	275	51	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48009.1	1.40e-146	1	321	57	378
QRQ48683.1	6.41e-143	1	323	57	379
QUB72247.1	1.48e-142	1	320	57	376
QUT45721.1	1.05e-141	1	323	57	379
ATV52763.1	2.80e-141	1	322	57	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.57e-19	15	286	73	348	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	7.57e-19	15	286	73	348	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	7.92e-54	1	320	61	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	4.10e-50	1	309	61	377	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
B3E4H8	2.12e-49	2	323	64	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	1.77e-47	2	322	64	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q6ALW0	5.11e-47	2	320	67	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001975_02376.