CAZyme Information: MGYG000001976_01555

Basic Information

• Species: Sutterella seckii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella seckii_A
• CAZyme ID: MGYG000001976_01555
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270		30644.7	7.2077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001976	1701575	MAG	Denmark	Europe

• Gene Location: Start: 966; End: 1778 Strand: -

Full Sequence      

MHYVSPSIWAWRPERIHQIRRAVDHMLLVFPFEEEIYRRAGIDATYVGHPLASVIPMEPD
TMGARRDYGLTEDTLPVVTIMPGSRLDEVKGCAPAFFGAVEKLLHRYGDMHVLIPAADEE
ARERIIFIAGQYARLAQRMIVRIGESHRMIEAADAVLVASGTATLECALYKKPMVVGYSM
PALTGMIMQKKALIRHVSLPNILMGESVVPEFLQYYCRADQISWALEDALENDAKRKELA
ERFTKLHEALKRDTSALVADVLEKRALRRW

Enzyme Prediction     

No EC number prediction in MGYG000001976_01555.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	251	3.3e-81	0.6864406779661016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.08e-103	2	263	114	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.48e-90	1	256	115	368	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.94e-65	1	248	112	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.19e-57	1	263	117	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.73e-29	1	264	106	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA54177.1	2.66e-187	1	270	124	393
QQS88891.1	5.46e-168	1	270	123	392
BBF22932.1	3.63e-138	1	269	124	391
ANU65980.1	5.40e-82	1	264	118	383
QQQ97139.1	5.40e-82	1	264	118	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.05e-45	1	251	118	366	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	8.43e-45	1	251	118	366	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q13XC9	2.09e-72	1	268	120	388	Lipid-A-disaccharide synthase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=lpxB PE=3 SV=1
B2JIB3	2.95e-72	1	262	120	378	Lipid-A-disaccharide synthase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=lpxB PE=3 SV=1
B2T5I1	2.95e-72	1	265	120	385	Lipid-A-disaccharide synthase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=lpxB PE=3 SV=1
Q1LNE5	6.48e-71	1	262	133	391	Lipid-A-disaccharide synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=lpxB PE=3 SV=1
Q470F0	5.89e-69	1	262	134	392	Lipid-A-disaccharide synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) OX=264198 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001976_01555.