CAZyme Information: MGYG000001977_00072

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_00072
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000001977_1|CGC2	37106.23	4.7479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 80333; End: 81313 Strand: +

Full Sequence      

MRKMWKIMLVVCCLGMTVGCGTSPSKNERMEEALPVLVVNGTQLMNVEGDTVVLEGVSYG
WHQFWPRFYNASSVAYLVNEWGAKVLRASMGVDLDSACYVNKPEFGVECVTRVVDAAIEN
DVYVIIDWHSHNLRQEEAKEFFTQMAIRYKGVPNIIYEIFNEPVEDSWEQVKAYSVEIIK
AIRAIEPDAVILVGCPHWDQDIHLAADDPITGYNNIMYTLHFYANTHGQWLRDRADYALG
KGLPVFVSECAGMEASGDGPINQEEWKNWLNWMQRHSISWVAWSLSDKDETCSMLYPSAS
SEGNWKDADMKEWGKAVRDNLKALKK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	281	1.8e-95	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.21e-57	45	289	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.05e-05	65	237	70	237	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT65069.1	2.50e-232	1	326	1	326
QBJ17986.1	2.50e-232	1	326	1	326
QUT62082.1	2.50e-232	1	326	1	326
QMI79433.1	2.50e-232	1	326	1	326
QQA30548.1	2.50e-232	1	326	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	1.27e-77	37	322	13	301	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
3PZT_A	7.50e-77	19	321	26	324	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
4XZW_A	7.83e-76	37	321	12	302	Endo-glucanasechimera C10 [uncultured bacterium]
5IHS_A	2.74e-73	37	322	35	321	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
1H11_A	1.66e-72	27	322	2	301	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07983	8.47e-75	16	325	17	333	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	3.33e-74	19	325	31	333	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	2.84e-72	19	325	31	333	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
O85465	6.75e-72	4	322	1	327	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	1.22e-71	18	322	20	327	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_00072.