CAZyme Information: MGYG000001977_00283

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_00283
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1031	MGYG000001977_5|CGC1	117439.18	6.1434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 12811; End: 15906 Strand: +

Full Sequence      

MKKHLITGLFAALALSASAQSFNEWLDPEVNAVNRAPMHTNYFAYESADAAAKGLKEQSA
NFMTLNGTWKFFWVKDADARPTDFWRVGYNDKGWHSMPVPGVWELNGFGDPIYVNVGYAW
RNQFQNNPPQVPTENNHVGSYRREIVVPADWKNKDIMAHFGSVTSNIYLWVNGRYVGYSE
DSKLEAEFDLTPYLKPGQKNLIAFQVFRWCDGTYLEDQDFFRYSGVGRDCYLYARDKKRI
QDIRVTPDLDADYRNGSLKVQLDVKGGGNVSLELLDAAGAQVATATGKGNGIVSMNVENP
HKWTAETPYLYTLRATLQGSGEVIPVKVGFRKIELKGAQILVNGQPVLFKGADRHEMDPD
GGYVVSRERMLQDIQVMKQFNLNAVRTCHYPDNNLWYDLCDQYGIYVVAEANIESHGMGY
GEKTLAKRADYRKAHLERNQRNVQRGFNHPSIIFWSLGNEAGYGSNFEAAYDWVKAEDPS
RACQYEQAGKNGKTDIYCPMYYGYEGCRKYCEDASMTKPLIQCEYAHAMGNSEGGFKEYW
DLVRKYPKFQGGFIWDFVDQSVRWTGKNGKMIYAYGGDFNRFDASDVNFCDNGLISPDRV
PNPHMYEVGRIYQDIWTTPVDLKNGEINVYNEYFFRDLSAYYMEWEVLKGGKVIRTGRID
NLNVAPQQTAKVKLDLGKTCQCTEWLLNVSYKLKNREGLLPAGHVVAKDQLTLNSYKAPS
MELKNYEQSNIGVTAPQVQTNDWKYLIVSGDAFRMEIDKHNGYLTKYEVNGQNMIKDGEA
LTPNFWRAPTDNDFGAGLQRKYIAWKNPEIKLTSFNQRTENNQVIVESVYDMPGVSAKLN
LTYVINNAGAIKVTQKLTADKNANVSNMFRFGLQMPMPRSFETVEYYGRGPVENYIDRNH
CTDLGIYRQSVTEQFYPYIRPQENGTKTDIRWWKMLDQSGNGIKIVAAAPFSASALHYTI
ESLDEGLDKQQGHSQEVDEADLTNLCIDKVQAGLGCEDSWGRIARPEYLVPYADYEFTFI
MMPVKHEIGVE

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	900	3.1e-219	0.9707446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	23	1019	15	1024	beta-galactosidase.
PRK10340	ebgA	0.0	23	1024	2	1000	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	6.37e-157	55	898	5	800	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
smart01038	Bgal_small_N	1.73e-101	749	1021	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02836	Glyco_hydro_2_C	8.12e-95	333	615	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI79220.1	0.0	1	1031	1	1031
QBJ17727.1	0.0	1	1031	1	1031
QPH58080.1	0.0	1	1031	1	1031
QUT33916.1	0.0	1	1031	1	1031
BBK85666.1	0.0	1	1031	1	1031

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	2.40e-238	24	1028	3	985	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.47e-238	24	1028	4	986	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	1.19e-221	24	1025	6	998	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	2.25e-211	20	1025	5	1002	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	4.05e-164	24	1020	15	1019	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.36e-237	24	1028	4	986	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	4.45e-204	16	1024	11	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q6LL68	1.99e-189	13	1023	1	1027	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
Q9K9C6	1.17e-186	25	1020	9	1008	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
P81650	1.08e-183	24	1021	12	1033	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999026	0.000186	0.000179	0.000165	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_00283.