CAZyme Information: MGYG000001977_00368

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_00368
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000001977_7|CGC1	43121.2	4.5933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 28236; End: 29369 Strand: +

Full Sequence      

MKKILFCLPLLLFVLQSCEIEDEYMYDKGLYTIDWEAAADSSSVTLIDRFWNVEGNYFNY
GNDGSIKDFHYWPQAHAMDVMIDAYNRTGDTKYSNLFDKWYAGIKAKNGGRYWNNFYDDM
EWIALTMIRLYEATDDGKYLQTAQEMWNEIKTGQNDYAGGGIAWTHDQPWSKNACSNGPA
ALIAARLYGINRNQEDLDWAVNIYKWEHENLFNPATGAIYDNVNGETGELNTLSLSYNQG
TFLGAAYELYKITGEESYLKDARKAANFGISNSGMIDTGNNLLRDEGDGDGGLFKGIFMR
YYVQLIMEPNLESTYKKKFITFFNNNAETLWRKGINKLDLLYNTNWAMNNSGNNHLTTQT
SGCTLIEAKALFEKSLK

Enzyme Prediction     

No EC number prediction in MGYG000001977_00368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	52	352	5.3e-87	0.8463687150837989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	5.92e-55	35	332	2	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.82e-47	35	346	3	323	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.04e-08	72	220	29	174	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam07221	GlcNAc_2-epim	5.86e-04	127	291	149	328	N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase). This family contains a number of eukaryotic and bacterial N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase) enzymes (EC:5.3.1.8) approximately 500 residues long. This converts N-acyl-D-glucosamine to N-acyl-D-mannosamine.
cd04434	LanC_like	0.001	80	270	60	252	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU01224.1	1.08e-270	1	377	1	377
QUT37354.1	1.08e-270	1	377	1	377
QQA30005.1	2.19e-270	1	377	1	377
BBK86488.1	2.19e-270	1	377	1	377
QUT65780.1	2.19e-270	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	9.12e-88	34	373	53	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.98e-86	34	373	54	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.37e-85	34	373	54	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	1.96e-50	67	373	41	341	ChainA, Lin0763 protein [Listeria innocua]
4D4A_A	6.36e-36	23	347	15	339	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000007	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_00368.