CAZyme Information: MGYG000001977_00518

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_00518
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	MGYG000001977_11|CGC1	28678.33	6.8509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 22102; End: 22869 Strand: +

Full Sequence      

MKRIFTAICVLMSLLPLLAQEAYQKETFISDRGDTLLYRLLRPQEMKAGEKYPLVLFLHG
AGERGNDNEKQLIHGGQMFLNPVNREKYPAFVLVPQCPETGYWAYTERPASFMPAEMPLE
VPVSPIFATLKELLDTYLAMPQVDKERIYVMGLSMGGMGTFDMAIRYPEVFAAAIPICGT
VNPERLKAAKPVKFRIFHGDADNVVIPEGSRAAYRALKAAGADVEYVEFPGCGHGSWNPA
FNEPDFMSWLFSRKR

Enzyme Prediction     

No EC number prediction in MGYG000001977_00518.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	37	237	3.2e-28	0.8810572687224669

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	7.25e-47	14	255	157	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	6.12e-20	7	235	346	595	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	1.20e-12	53	234	19	188	Predicted esterase [General function prediction only].
COG3509	LpqC	1.54e-11	18	209	30	208	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
pfam00326	Peptidase_S9	4.42e-11	120	242	42	195	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	1.96e-51	36	255	22	245
BCI61582.1	2.38e-43	16	254	804	1042
QJW99051.1	2.04e-38	18	255	29	240
VTR91196.1	7.65e-35	18	255	28	239
QDU56037.1	2.67e-32	21	255	789	1007

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.58e-47	16	255	128	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	2.70e-23	32	255	17	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	1.78e-11	19	255	34	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
7JIZ_A	2.79e-06	134	239	112	218	ChainA, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7],7JIZ_B Chain B, Dienelactone hydrolase family protein [Solimonas sp. K1W22B-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0J969	8.93e-09	43	234	42	240	Probable carboxylesterase Os04g0669500 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0669500 PE=3 SV=1
Q0J968	4.34e-08	46	234	3	199	Probable carboxylesterase Os04g0669600 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0669600 PE=2 SV=1
D5EY13	6.46e-07	50	249	533	713	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.999026	0.000199	0.000158	0.000153	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_00518.