CAZyme Information: MGYG000001977_01491

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_01491
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000001977_49|CGC1	32710.75	4.6044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 8980; End: 9861 Strand: +

Full Sequence      

MKLNLKYIAVACAITCMAGCDDKLEVTGTNIAPVAIAASAVQTEALPGEIKLKWTAPQED
FAYMQIKYNDPLQKKDIYEIVSKGTTELLIEGTRARFGDYSFFFQTFNVAHQGSAVTEVK
AKSGIAPTTLTEVKRTKVELTADQLSSNYPEPTEGPIKNLLDGNTGTFFHTRWSSPQADL
PHYIQVDFNEEHEDFAIKYTTRNVGNKDGFPTIAELQISNDGENWETLSTLSGLPTTSAT
DYTSVFVMPGKKFKYFRFNVTAVSLNSKYFHMSEFSFYDVEVDTYDPETVPLD

Enzyme Prediction     

No EC number prediction in MGYG000001977_01491.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	144	275	8.8e-18	0.9354838709677419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	7.70e-18	144	275	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	2.05e-08	140	262	14	130	Substituted updates: Jan 31, 2002
smart00231	FA58C	0.001	151	262	18	125	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP56724.1	4.80e-129	1	293	1	297
QQT78032.1	4.80e-129	1	293	1	297
QUU07363.1	4.80e-129	1	293	1	297
QUT89968.1	2.96e-128	1	293	1	299
ALK86788.1	4.60e-95	1	293	1	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2J7M_A	5.63e-08	138	230	11	99	Characterizationof a Family 32 CBM [Clostridium perfringens]
2J1A_A	5.73e-08	138	230	12	100	Structureof CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in complex with galactose [Clostridium perfringens ATCC 13124],2J1E_A High Resolution Crystal Structure of CBM32 from a N-acetyl-beta- hexosaminidase in complex with lacNAc [Clostridium perfringens ATCC 13124]
2V5D_A	1.84e-07	130	230	591	687	Structureof a Family 84 Glycoside Hydrolase and a Family 32 Carbohydrate-Binding Module in Tandem from Clostridium perfringens. [Clostridium perfringens]
3F2Z_A	2.30e-07	155	228	28	100	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]
1W8N_A	4.08e-07	83	274	405	594	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	1.08e-06	130	230	621	717	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.08e-06	130	230	621	717	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q02834	2.29e-06	83	274	451	640	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_01491.