CAZyme Information: MGYG000001977_02269

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_02269
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	MGYG000001977_100|CGC1	68996.42	6.827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 938; End: 2755 Strand: +

Full Sequence      

MRRLFLISSFLTLFAIGSSAQWKPTGDKIKTDWASRIDPANVLPEYPRPIMERSDWKNLN
GLWNYAVISKGEHLPAEFEGQILVPFAIESSLSGVGKRINENQELVYQRTFEVPSAWKGK
QVLLHFGAVDWKTDVWVNDVKVGSHTGGFTPFSFDITAALSAKGSNRLVVKVWDPTDKGP
QPRGKQVSNPEGIWYTPVSGIWQTVWMEPVAGKHIENLRITPDIDSNLLTVKAELNMECP
SDFVEVNVYDGSQLVATGKSINAEPVEVSMPRNAKLWSPDSPFLYTLKVTLKSGGKVVDK
VDSYAAMRKYSTRRDADGIVRLELNNKALFQFGPLDQGWWPDGLYTAPTDEALLYDVQKT
KDFGFNMIRKHIKVEPARWYTHCDRLGIIVWQDMPSGDRGPEWQMRQYFNGTERKRSAES
EATYRKEWKEIMDCLYSYPCIGTWVPFNEAWGQFKTVEIAEWTKQYDPTRLVNPASGGNH
YACGDMLDLHHYPKPELFLYDGQRATVLGEYGGIGLVLKDHIWEPNRNWGYVQFNSSKEV
TDEYAKYADILYQLISKGFSAAVYTQTTDVEVEVNGLMTYDRKVIKLDEKRVKEINTRIC
NALKK

Enzyme Prediction     

No EC number prediction in MGYG000001977_02269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	500	3.3e-106	0.5159574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.09e-38	54	513	10	477	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.19e-28	48	299	3	267	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.89e-18	54	481	39	474	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	7.93e-18	57	207	2	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	5.94e-13	214	308	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH58832.1	0.0	1	605	1	605
QMI79934.1	0.0	1	605	1	605
QBJ18527.1	0.0	1	605	1	605
QUT61493.1	0.0	1	605	1	605
QQA29983.1	0.0	1	605	1	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	0.0	18	605	1	588	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6S6Z_A	8.51e-26	27	499	15	491	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	8.52e-26	27	499	16	492	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3GM8_A	4.18e-22	107	472	70	421	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5EUV_A	1.55e-21	57	472	5	389	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d],5EUV_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d],5LDR_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	4.66e-25	27	499	16	492	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KPJ7	1.06e-22	107	449	107	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	9.08e-22	107	450	60	389	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	6.46e-21	107	477	110	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q48727	1.46e-20	30	485	12	460	Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=lacZ PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000715	0.998362	0.000234	0.000237	0.000210	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_02269.