CAZyme Information: MGYG000001977_02279

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_02279
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000001977_101|CGC1	39362.51	4.4049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 10757; End: 11818 Strand: +

Full Sequence      

MKMITILSALALTTAVCCGSCSEDGPVTNPRQEDTSIIVKETGFARGADVSWLTQMESEG
RKFYTPGEDRQEMECMQLLRDYCGVNSIRLRVWVNPKDGWNSMDDVVLKARRAESLGLRT
MIDFHFSDTWADPGHQEMPEAWKTLSFDDLTKAVGNHVTETLNALKNAGVTPEWVQIGNE
TTPGMMLPVGSVDNPVQLTRLNNAGYEAVKSVFPEAMVIVHLDGGNNQWAYDRMFDILEN
NGGKYDMIGMSLYPYWAEQQGESGGWQKVADDCIANINHLKQKYNKPVMICEIGMPYDQG
ELCKQLITKMMGAAVEGAFYWEPEAPNGYNDGYNLGCFDNDAPTVALDAFKNK

Enzyme Prediction     

No EC number prediction in MGYG000001977_02279.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	46	325	9.7e-90	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.89e-95	45	350	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	2.58e-81	15	333	7	353	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT42647.1	9.38e-221	1	351	1	351
BCA49296.1	9.38e-221	1	351	1	351
QUT70301.1	1.33e-220	1	351	1	351
QMW86976.1	3.82e-220	1	351	1	351
AAO79773.1	3.82e-220	1	351	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GP5_A	2.03e-216	19	351	18	350	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],6GP5_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GPA_A	2.80e-207	38	351	1	314	Beta-1,4-galactanasefrom Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482],6GPA_B Beta-1,4-galactanase from Bacteroides thetaiotaomicron with galactose [Bacteroides thetaiotaomicron VPI-5482]
1HJS_A	2.46e-40	46	296	5	249	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
7OSK_A	8.42e-39	44	292	50	292	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
4BF7_A	5.71e-38	46	340	22	330	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	3.54e-48	39	323	1	310	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
P83692	1.35e-39	46	296	5	249	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1
B0XPR3	4.61e-38	46	296	26	272	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
A1D3T4	6.43e-38	46	296	26	272	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
Q4WJ80	2.43e-37	46	296	26	272	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000104	0.022769	0.977093	0.000014	0.000021	0.000015

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_02279.