CAZyme Information: MGYG000001977_03303

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000001977_03303
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000001977_219|CGC1	37287.87	6.8686

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001977	4322077	MAG	Denmark	Europe

• Gene Location: Start: 5119; End: 6081 Strand: -

Full Sequence      

MKRFLSPNFLPTPANKRVSLSRSVAYNLTRLPVYLKSMHYIRHRIEESGAELVINFYELL
AGLTYLLFRPSVPQISVGHQYLFLHRDFEFPDKRGFNLWLLRFFTRLTCIGACKKLALSF
REMEDDEEAHIHVVPPLLRKEVLSCEGTEENYLHGYMVNSGFGENIRCWHSIHREIPLHF
FWDKQDEPDVCCVDDTLSFHRLDDIKFLRYMAGCKAYATTAGFESVCEAMYLGKPLLMVP
VHIEQDCNAYDAARSGAGVISEEFDLERLLTFSEHFHPNMAFRYWARSCGWRILHHIESG
MSLSHSPAPVSPYFYCHFQL

Enzyme Prediction     

No EC number prediction in MGYG000001977_03303.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13528	Glyco_trans_1_3	8.46e-19	15	272	61	316	Glycosyl transferase family 1.
COG1819	YjiC	3.52e-04	189	260	276	347	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	0.001	225	268	319	362	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
cd03785	GT28_MurG	0.007	214	271	258	316	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT36420.1	4.29e-200	1	298	57	354
QQA28359.1	4.29e-200	1	298	57	354
QUT63690.1	4.29e-200	1	298	57	354
QBJ20060.1	8.66e-200	1	298	57	354
QMI81438.1	7.10e-199	1	298	57	354

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999990	0.000031	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001977_03303.