CAZyme Information: MGYG000001980_00666

Basic Information

• Species: Phascolarctobacterium sp900554395
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp900554395
• CAZyme ID: MGYG000001980_00666
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	MGYG000001980_51|CGC1	58622.39	6.8402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001980	1621882	MAG	Spain	Europe

• Gene Location: Start: 6716; End: 8266 Strand: +

Full Sequence      

MKNLNLQSLIIIAVLALITIMWGIGSVPLFDPDEPVYAETAREMIKYSDYLSPRIFDNYW
YDKPPMYYWLVAASIGLFGDGEAAARFPAALMAVATTVMLYFSVSKIFSERAGFWSSIVL
TTCVEFFYLGKAAVTDTTLLFFMTAALLCYLHKWYWVMYVAMALATVTKGPIGIVFPGAI
IFLHLLATGNLREILKMHVIRGLAVYFAIAAPWYYLMYQVHGMEFINTFLGFHNLTRFTT
PEHPDRVLWWYYLPVIILGMFPWTGLLVQSVRASISEASSEDLEKMSFFNIWWIFVLLFF
SISQTKLVSYILPMFPALAIIIGWNIARLENQRGESLLSWVIGTIVMFGLLGAGWFIGGR
ELPEAALEASVLSGITVVIGLVILWFLWRERDVIFAGYLHAAMGFLTMLVAFSFILPPVA
DRFSVKTMAAEYMASCDTTKTVYVDKFLRPGFMYYTGIAGEEMLPKTDALQKAVTDAAPK
YIVVRRLEYKRLEKPEAIQNIRIVNEKDGIMILEKY

Enzyme Prediction     

No EC number prediction in MGYG000001980_00666.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	434	4.1e-116	0.8240740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	5.88e-59	8	416	9	429	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.58e-32	9	387	8	401	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.04e-20	62	215	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.87e-09	10	226	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77242.1	9.66e-231	1	515	1	518
AOH48432.1	1.96e-173	2	514	5	524
QNH53437.1	3.65e-171	2	514	5	524
ANR70824.1	4.78e-169	2	514	5	524
AME03144.1	1.13e-159	2	512	5	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.46e-32	29	353	54	390	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	4.46e-31	6	350	2	348	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	5.25e-31	7	350	3	330	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
Q6D2F3	6.34e-30	5	382	7	391	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C6DAW3	1.16e-29	5	380	7	395	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
C5BDQ8	3.07e-28	15	380	10	392	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996418	0.001571	0.000245	0.000008	0.000007	0.001777

TMHMM  Annotations     

start	end
7	29
83	105
112	129
139	158
165	187
197	216
247	266
286	303
308	327
337	359
366	388
398	420