CAZyme Information: MGYG000001980_01055

Basic Information

• Species: Phascolarctobacterium sp900554395
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp900554395
• CAZyme ID: MGYG000001980_01055
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		24045.66	7.1625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001980	1621882	MAG	Spain	Europe

• Gene Location: Start: 5527; End: 6138 Strand: +

Full Sequence      

MARRKKKKLLDRWTVKFLLVAIAFFIIGEAGIKIWNSEAVQTRFVYMWPYQEEILEYSAK
NKIDPFLVAAVIKNESGFDTEAVSHAGAIGLMQIMPETGAWIASQMGLEFDFDALHTPEY
NVRLGCWDLGELEYEFQRNWVLMMIAYNAGRGNTRAWMQENGWNYDFNRIEDIPYPDTRE
YVKKVLRDRDKYYLFYKNKLKNY

Enzyme Prediction     

No EC number prediction in MGYG000001980_01055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	57	191	2.1e-27	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.20e-72	48	191	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.50e-54	49	197	5	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.15e-35	65	187	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.29e-29	49	203	138	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.08e-22	54	163	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBG64618.1	4.87e-102	1	203	1	201
QNP77119.1	2.75e-99	13	203	26	212
QTV76946.1	8.22e-88	2	201	7	206
ADB46849.1	4.26e-67	18	203	13	199
AEQ23289.1	7.79e-65	6	192	2	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.80e-23	46	186	412	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.82e-23	46	186	416	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.85e-23	46	186	422	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.87e-23	46	186	426	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.89e-23	46	186	432	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.39e-15	60	185	70	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC3	2.15e-14	33	196	467	628	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.15e-14	33	196	467	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	5.36e-14	33	193	467	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	8.60e-14	46	191	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992142	0.007514	0.000068	0.000017	0.000015	0.000264

TMHMM  Annotations     

start	end
13	35