CAZyme Information: MGYG000001981_00141

Basic Information

• Species: CAG-617 sp000431275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000431275
• CAZyme ID: MGYG000001981_00141
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1104	MGYG000001981_1|CGC4	122059.22	4.6279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001981	2121938	MAG	Spain	Europe

• Gene Location: Start: 178658; End: 181972 Strand: -

Full Sequence      

MNLKKHILWAVMAFPLTATAQEITFESEDYKAIGVYDSWEESPFRTGTLKGNAAVVSNHL
SQVNETLGFAPNSTGHILGFQRSRFGSNLYGARIDLSETFELTKTTKYVHVMIHKPTDGR
MMLIGLGKRRERAGQSPEAEQFWALSSLPATPGEWCDAVFPIKGAGGIDIYSLVVVPDCE
SPHALTSDYAVYIDEIVVNDSPTPRFRLGDYVINYDESTTVNRSERKFTGITLKGSADGD
QSMNWGTLNPTPIHYTLLDKSFTAKAGETLTPAFGYTDTWLNGYIYLDRGNDGKFEATLN
DDYTIPEGSDIMTYAYVETVAGTEGYFSDGTKVTGSSRNVLNPPAFTVPADLPNGYYRIR
FKLDWGNVDPGGSTTIVTDGGMIFDTRLNVHGDFCPVTSANRNGDVLTETGTTLNGYQAP
FGQPLTVKMDPEEGFTYDGIRVRYGYNLAGDSLIHGTPQYVEVVYPAYLFRDDTFTIPAE
IMTANVQVEGLFVEVNGETPETGNDYPLNFDKSLTIERTDRRLNRINITGTAGGTKTIRI
DDEGDNYVYRNMTNKEISLVPGDKVTTGIDYTGNSMHEYLYIDFNQDGQFNTSLDGNGVP
TLSGELVSYTYFNGKNSLGETITGAPGSVRLDSMPAFTLPATMPTGVYRARLKVDWNNID
PAGQWSEGGANQINANGGYIVDFLVNVHNAEHKLDLHSKNGSIYGPDNTGLPLTIPCFKS
LRIFPTAVASGYQADSMTIRHGHNFDGPQYVHGNRQWSEFKTRARTYTIPQDSINGDVAV
YVNFEPTDRATYKLIFADEFNGPDGTQPDADAWHRCLRESATWNRWLSDSEDVIYLSDGK
LVARAIPNPDQESDPVPMITGGVESSGLFDFQYGKIEARILTHPHSGNFPAFWLMPTDQS
KGWPNDGEIDIWEQIDAQNTAYHTVHSNWTYTLGNTSNPKSSYNESVEMDRYHTYGLEWN
ESSLRWYVDGKQVGSYAKSTDTEALTNGQWPFDKAFYIILNQSVGNGSWAADADVDHTYE
TLFDWVRVYQYGTSVGIGNITDKPTFSVSASRGQIHISSDRPAALAVTDAAGRVHWCGTV
DGQPHTVNVPTGIYIVAGHKVLVP

Enzyme Prediction     

No EC number prediction in MGYG000001981_00141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	797	1029	2e-51	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.82e-60	796	1029	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	2.08e-27	798	1029	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	1.78e-20	792	1030	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd02178	GH16_beta_agarase	8.79e-19	796	1030	25	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd08024	GH16_CCF	1.09e-18	857	1005	98	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	1.29e-192	1	812	5	807
QFQ13169.1	2.25e-116	504	1030	23	541
QUB87116.1	1.55e-84	792	1100	48	331
AKU69476.1	1.55e-84	792	1100	48	331
QUB75565.1	1.06e-82	785	1038	41	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	1.37e-40	787	1031	24	263	ChainAAA, Beta-glycosidase [Bacteroides caccae]
4CRQ_A	7.12e-28	792	1032	3	233	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
2HYK_A	8.19e-27	789	1032	6	245	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
6XOF_A	1.21e-25	792	1030	24	267	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	5.56e-25	792	1030	24	267	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	9.48e-36	769	1030	33	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P23903	2.43e-22	786	1030	415	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	3.45e-14	792	1071	25	287	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
O33680	5.01e-11	788	1029	214	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q9Z3Q2	1.42e-09	788	1029	214	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.999000	0.000191	0.000174	0.000161	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001981_00141.