CAZyme Information: MGYG000001981_01712

Basic Information

• Species: CAG-617 sp000431275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617; CAG-617 sp000431275
• CAZyme ID: MGYG000001981_01712
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		55623.92	4.5722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001981	2121938	MAG	Spain	Europe

• Gene Location: Start: 1865; End: 3361 Strand: -

Full Sequence      

MKKITTSLLGLLAAGLVCLPAPAQELFEQQEIPNPDNTPSPVFPVPTQRQLDWMEMEFYG
FSHYGYNTFIDKEWGNDIKPDPTHYAPQSIPNCDQWVSTMKSAGMTGVVVICKHHDGFCL
WPTTSTDFCVTNSGGVGPQVDIPKLVSEACKKYDMKFGVYLSPWDASAATYATQDYVDGI
FKTQLEELLTNYGDVFEVWFDGANGGTGFYGGETATTKTIDKTTYYDWANVAAYIHKVQP
NAVVWGREFRWCGNEAGYSGRTCWANSDIRSVQSEGNNNTGYEEGFEFIPSESDVRTSQN
WFWHANENIKSAEELYKIYLETVGRNATLIMNCAANTDGVLSDTQVRNLGQLGELLETRL
TNNFALTATSITADQVRDGGKYDAKNVADNDKETYWATNDGQTTGSVTIELPETQQVHYV
MLQEYMKLGQRVRAFNIEFSTDGSTWRSFAEGTTIGHKRIMARNDDTSSYGRGIPAKYIR
VNITDSRACPLLSNIAIY

Enzyme Prediction     

No EC number prediction in MGYG000001981_01712.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	47	357	8.2e-64	0.8641618497109826
CBM32	377	485	2.3e-16	0.782258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.97e-46	39	498	4	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	9.40e-32	52	357	44	329	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	9.60e-29	94	356	84	330	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	3.87e-12	370	486	1	115	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.14e-06	363	484	11	129	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF11782.1	3.25e-236	2	498	6	499
QFQ12382.1	8.49e-151	1	498	1	492
QFQ12303.1	3.90e-149	1	498	1	492
QUB82373.1	5.74e-145	9	498	13	509
AUI56213.1	5.74e-145	9	498	13	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EYP_A	5.29e-85	45	498	9	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
5K9H_A	4.50e-84	41	498	34	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	9.02e-82	45	498	31	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	6.79e-81	46	496	19	474	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	7.99e-79	46	496	19	474	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	9.73e-85	1	498	1	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	3.36e-82	39	498	31	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
P49713	5.52e-09	68	202	73	211	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q9VTJ4	3.04e-08	42	202	63	229	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
P10901	3.79e-08	92	356	106	353	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001528	0.997294	0.000392	0.000297	0.000236	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001981_01712.