CAZyme Information: MGYG000001985_00688

Basic Information

• Species: CAG-495 sp900540425
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900540425
• CAZyme ID: MGYG000001985_00688
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000001985_6|CGC1	28465.59	10.4236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001985	1740183	MAG	Spain	Europe

• Gene Location: Start: 25388; End: 26146 Strand: +

Full Sequence      

MLLTMLQPIQARADEQARVRDAYACMNATIELEKEYQIQEHLLTTISSVETGRWDAATRQ
NVAWPWTVNAMGKGTFYPSKAEAIRAVKKLQAQGVKSIDVGCMQINLSYHPDAFENLEEA
FDPKTNVAYGAKFLKNLYENRGNDWIKAAMAYHSSVPKKALRYKKKLFTAYEKVKQAQNL
RRQNQNTVKTAVAKIPGQLKKTARVHADAAHTATVASNPQREARLIADAKAWREAKLAEY
RQRKSNRLAAAN

Enzyme Prediction     

No EC number prediction in MGYG000001985_00688.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	33	179	1.5e-16	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	4.25e-15	36	173	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16892	LT_VirB1-like	2.80e-09	68	139	31	101	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	5.19e-07	96	167	32	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	1.17e-05	100	153	43	103	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.91e-05	1	205	83	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10590.1	9.80e-62	5	179	2	175
CAX83981.1	1.13e-48	25	251	33	275
CDK98691.1	8.09e-46	33	245	31	242
AVM77174.1	1.14e-45	33	245	31	242
AVM73271.1	1.14e-45	33	245	31	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.838263	0.160438	0.000527	0.000344	0.000167	0.000267

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001985_00688.