CAZyme Information: MGYG000001985_01048

Basic Information

• Species: CAG-495 sp900540425
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900540425
• CAZyme ID: MGYG000001985_01048
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749	MGYG000001985_11|CGC1	86856.65	6.052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001985	1740183	MAG	Spain	Europe

• Gene Location: Start: 25113; End: 27362 Strand: +

Full Sequence      

MNLEVFLTLILESWIRGIFMENLLSKAEMEAVINGDHGNVFSVLGIHKDKGSKEVFIRAY
QPHAVSIEVLRYDDSPVGFMTRLDDRGFFQINLGAVENFPYRFRIENDMGHKYIKEDEYR
FPPVLGDIDVYLLAEGNHLEMYKKLGAHPMEINGVKGVGFAVWAPNAKRVSVVGAFNNWD
GRAHVMRKHPTCGVWDIFVPGIGEGEFYKYEVKTPEDYILVKSDPVGFYAEKRPNTASVV
YDINRYQWSDENWMKYREQANSFDRPMSIYEVHLGSWRRKENNEFMTYRELADTLVPYVT
NMGFTHVEFLPLCEHPLDCSWGYQVVGMFAPTSRFGTPDDLRYLIDKFHEAGIGVIMDWV
PAHFPKDGHGLNEFDGTHLYEHADPRKGEHRDWGTKIYNYGRNEVCNFLCASALYWLKEF
HIDGLRVDAVASMLYLDYSRKNGEWIPNQYGGNENLEAISFLRKMNELVYGQCKGAFTCA
EESTAWPMVSRPTSMGGLGFGYKWNMGWMNDTLRYISKDPVYRKYEHGKLTFGLLYAFNE
NFILPISHDEVVHGKGSMLSKMPGDEWQKFANLRAYYGFMYTHPGKKLLFMGCEFGHDWE
WNSEEGLRWFLLEHPMYKGMQNCVRDLNLMYKGNAPLYQIDFDYRGFEWIDHSNANDSVI
SYMRKGETPGDYLIVVCNFTPVVRHDYRIGVNEFCRYQEIFNSDDVNYWGSGVKNEGFMQ
AENVPCNDKPNSVRLTLPPLSTIVIKPVR

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	297	596	1.4e-162	0.9933554817275747
CBM48	144	226	3.8e-19	0.8552631578947368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	24	749	1	725	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	145	748	27	622	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	29	747	508	1222	glycogen branching enzyme; Provisional
PRK12313	PRK12313	0.0	123	749	5	629	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	120	747	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABG03292.1	0.0	29	747	7	719
BBL80851.1	0.0	29	747	7	719
QYJ16550.1	0.0	29	747	7	718
VBB68904.1	0.0	32	747	13	734
AHY45476.1	0.0	25	747	5	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GR1_A	2.38e-285	16	746	17	772	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	4.79e-285	16	746	17	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQW_A	4.79e-285	16	746	17	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR0_A	6.79e-285	16	746	17	772	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	6.79e-285	16	746	17	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1AZ86	0.0	29	747	7	719	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q2RR72	4.10e-318	26	747	4	732	1,4-alpha-glucan branching enzyme GlgB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=glgB PE=3 SV=1
Q2W2Q6	1.28e-308	16	746	8	737	1,4-alpha-glucan branching enzyme GlgB OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=glgB PE=3 SV=1
A3PIQ5	4.86e-303	23	747	10	727	1,4-alpha-glucan branching enzyme GlgB OS=Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) OX=349101 GN=glgB PE=3 SV=1
Q3J3M6	1.13e-301	23	747	10	727	1,4-alpha-glucan branching enzyme GlgB OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999960	0.000066	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001985_01048.