CAZyme Information: MGYG000001985_01110

Basic Information

• Species: CAG-495 sp900540425
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900540425
• CAZyme ID: MGYG000001985_01110
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000001985_13|CGC1	39959.69	7.6072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001985	1740183	MAG	Spain	Europe

• Gene Location: Start: 8151; End: 9242 Strand: +

Full Sequence      

MEKPILAAMLSCSGLSLTDAEKRLFSRYNPLGVSLFGRNIASPRQLRQLVADIKTAIGRN
DVLIGIDQEGGRVRRLSEPDYRTYASQYRLGQIARRFGLETGEQTAAAHALLISQDLYAA
GINWNYAPVIDVCHRETSAVLRSRTFGSDRKIIAALGQKMVDTYIENGICPCIKHLPGLG
SSSTDPHLQMPVIALPLSKLQTDFRPFKKLRNSPAGMTAHIMLPEIDSQYPLTQSAAGIS
RIIRGELGFAGFLISDAVDMHALRGSLSERVQSALTAGCDCVCYCGGKAGELEEVAAAAQ
NLRDNSLFRFEKIQKIIHNKPVLAETGRLAENYEQQIGRVEEYNDDYDATETLNLMQNKK
GEI

Enzyme Prediction     

No EC number prediction in MGYG000001985_01110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	62	283	3.1e-36	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.45e-66	1	299	1	294	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	3.67e-53	9	285	5	280	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	3.36e-47	9	296	11	296	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10689.1	3.15e-106	7	356	4	337
QPC41685.1	3.38e-72	5	329	3	333
QKP77738.1	3.78e-71	7	318	5	315
CDK98255.1	4.01e-71	7	331	10	334
AVM77618.1	4.01e-71	7	331	10	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VI6_A	2.24e-39	5	316	1	306	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
3TEV_A	9.58e-39	19	325	32	336	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
4GVF_A	9.43e-38	9	318	5	305	Crystalstructure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVF_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4GVI_A	4.96e-37	9	318	5	305	Crystalstructure of mutant (D248N) Salmonella typhimurium family 3 glycoside hydrolase (NagZ) in complex with GlcNAc-1,6-anhMurNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVI_B Crystal structure of mutant (D248N) Salmonella typhimurium family 3 glycoside hydrolase (NagZ) in complex with GlcNAc-1,6-anhMurNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5G1M_A	1.02e-36	9	314	26	323	Crystalstructure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G1M_B Crystal structure of NagZ from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5G2M_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G2M_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with N-acetylglucosamine [Pseudomonas aeruginosa PAO1],5G3R_A Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G3R_B Crystal Structure Of Nagz From Pseudomonas Aeruginosa In Complex With N-acetylglucosamine And L-ala-1,6-anhydromurnac [Pseudomonas aeruginosa PAO1],5G5K_A Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1],5G5K_B Crystal structure of NagZ from Pseudomonas aeruginosa in complex with the inhibitor 2-acetamido-1,2-dideoxynojirimycin [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5XXG4	3.52e-42	9	318	5	305	Beta-hexosaminidase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=nagZ PE=3 SV=1
Q2KXM7	6.72e-40	9	285	16	293	Beta-hexosaminidase OS=Bordetella avium (strain 197N) OX=360910 GN=nagZ PE=3 SV=1
A7MFT1	1.50e-39	9	340	5	327	Beta-hexosaminidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=nagZ PE=3 SV=1
Q32EW7	2.93e-39	9	336	5	337	Beta-hexosaminidase OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=nagZ PE=3 SV=1
B7LT32	2.93e-39	9	336	5	337	Beta-hexosaminidase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001985_01110.