CAZyme Information: MGYG000001985_01134

Basic Information

• Species: CAG-495 sp900540425
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900540425
• CAZyme ID: MGYG000001985_01134
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000001985_13|CGC2	40693.39	10.2904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001985	1740183	MAG	Spain	Europe

• Gene Location: Start: 30953; End: 32071 Strand: -

Full Sequence      

MKHIRKKEKPLIVLTAGGTGGHVYPAEALAEELLKRGYRLALITDNRGKNNYKGRLGEIP
NYAVYAGALVGKSRWFKIKSLFKTCVGIMQAGVFMLKNRPACVVGFGGYASFPAAMAAIL
LGRDLVIHEQNAVMSRTNRFLSKYAELTAQSFRNVKYAPKNGRQAVTGMPVRQSIALLAG
HNYPERTAAQKFQLMVLGGSQGAKVFAEVIPQAVAELPESQQKKLRIFQQCRDCDVKSLQ
EAYAATKAEVTVSHFFGNMDELYVGTHLIISRAGASSVSEIAVAGVPSILVPLPIAADDH
QTQNAAEINKAGAGIVLKQKDFTVQKLKELLEDFIKNPKELKKMSDKAHKVGIKNAAERL
ADAIEKEISVKW

Enzyme Prediction     

No EC number prediction in MGYG000001985_01134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	194	355	4.4e-47	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	9.49e-132	9	368	1	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	2.21e-119	12	362	2	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.16e-106	12	368	3	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.71e-97	12	364	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	8.88e-41	194	360	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10292.1	1.35e-149	7	368	5	366
BAE52652.1	5.71e-93	8	364	4	361
CUW38580.1	8.07e-93	9	364	5	361
ARJ66991.1	3.23e-92	11	364	7	361
AVM80177.1	7.09e-91	9	364	3	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.76e-58	12	363	5	350	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	8.33e-57	12	366	12	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	7.55e-41	12	366	9	352	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W0H3	1.14e-93	8	364	4	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=murG PE=3 SV=1
Q2RVU4	1.09e-86	12	364	19	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=murG PE=3 SV=1
Q5FUJ5	2.03e-81	12	365	5	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=murG PE=3 SV=1
B6IRG2	2.18e-81	12	364	6	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=murG PE=3 SV=1
Q0BV25	3.94e-77	12	368	10	368	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
100	122