CAZyme Information: MGYG000001986_00520

Basic Information

• Species: Collinsella sp900547855
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900547855
• CAZyme ID: MGYG000001986_00520
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000001986_6|CGC1	79584.3	4.9063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001986	2055219	MAG	Spain	Europe

• Gene Location: Start: 46076; End: 48241 Strand: -

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAAADQLYPDAEQPVTIHIEPGEYRERVEIHRPYVT
LVGETADSVRIVGSLGAKMPSGDGSGVDGTLGTFRTYAVLVDADDVRLENLTIENDAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPHEAKPGGFIGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGACAYFEGCEIRSLNRNMDVNGYVTAASTPEGEPYGFVFHGCSFT
APQDVAPDSVYLGRPWREWAQTVLIDCWLGQHIKCEGWWDWAKPAAHERAHYAGASLHGP
ASDAENWAPWAHELDATATTRYAREQVLSGADGWDPEGGPGDAAETDSLSDNGRTVHIDT
YYEDELAFRERLKREGRSAAFKGTTPEDFEAWQIATRVRLFDLLGLSIIDRVSIDARELD
RVQIAGGIVRTHAMLQVERDVWMPFYLLEPSHPKLDERGLKRCYICPHGHQGAGAASVAG
VVGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSFLRGTCLN
QARMSEPLGLTVAGLNAWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
CKTFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPRPLLVQSCEEDHLN
GSRGLKNVDEQLKIVRDAYKLLGRRDALRHEVCPGEHHLGVTHLVEDIEWLDSHVSKCDR
A

Enzyme Prediction     

No EC number prediction in MGYG000001986_00520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	3.8e-82	0.9826388888888888
CE19	464	698	3.5e-26	0.5753012048192772

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	9.26e-68	6	308	81	385	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.11e-49	16	311	10	275	Pectinesterase.
PLN02708	PLN02708	8.55e-43	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	4.79e-42	1	334	7	291	putative pectinesterase
PLN02773	PLN02773	1.39e-40	8	314	7	282	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	718	1	718
ATP54718.1	0.0	1	721	1	721
QUC03567.1	0.0	8	712	7	706
SET76962.1	3.23e-97	8	336	2	321
QJU20267.1	8.44e-97	8	336	18	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	7.89e-28	10	310	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.46e-24	16	305	17	272	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.98e-24	16	305	17	272	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
3UW0_A	1.46e-23	33	257	55	270	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.53e-22	18	257	18	246	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	7.93e-34	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O22256	1.53e-30	16	334	254	546	Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana OX=3702 GN=PME20 PE=2 SV=2
O81320	3.59e-30	10	328	167	453	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
Q9LVQ0	3.93e-30	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	5.10e-30	18	334	301	597	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001986_00520.