CAZyme Information: MGYG000001987_00080

Basic Information

• Species: UMGS363 sp900543105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900543105
• CAZyme ID: MGYG000001987_00080
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000001987_1|CGC3	69182.06	5.09

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001987	2697227	MAG	Spain	Europe

• Gene Location: Start: 101736; End: 103526 Strand: +

Full Sequence      

MLKFKNTDVTEAHLLPGLFKERSDVNRAYLMELKNEDLLQNFYLEACIRTDRDVTEMHLG
WESPTCQLRGHFLGHWLSAASMLIAQNGDRELKAKLDNIIDELERCQKLNGGRWVGSIPE
KYFEMLEKNYYVWSPQYTMHKTLLGLYHSAMYAKNEKALEILSNAADWYIEWTEKMEKVN
PHAVYSGEEGGMLEVWAGLYEYTHDERYFALAQRYSHPSIFKKLTDGGDPLSNCHANASV
PWAQGAAKMYEITEDSKWLEIVKKFWKCAVYDRESFCTGGQNSGEFWIPPHKLGMFIGER
TQEFCTVYNMVRLADYLYRFTGESEYLDYIEKNLYNGFLAQQNKFTGMPAYFLPMKSGSV
KKWGSKIHDFWCCHGTTVQAHTIYPMLCWYEDTENDRLVVGQYINSEYKRSENVTVTQNV
DMKYYNDGASFDEHDNSRMSRWYLKLNVNAKTPEKFTLSLRVPSWTVGEPEVCINGEKFD
GKAENGYISIERTWENDTINLHFPTALTMSSLPDMPQLTAFSEGPIVLAGLCSSDKGITM
ENDDPESALAYTIEHTYSTFPWQQSVYRTVNQPENFYLVPLYDVTDEPYTVYFTKR

Enzyme Prediction     

No EC number prediction in MGYG000001987_00080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	13	529	1.5e-159	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.96e-108	13	529	3	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.27e-68	26	535	26	507	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	5.98e-05	88	334	290	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam05147	LANC_like	0.002	143	299	166	327	Lanthionine synthetase C-like protein. Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs. Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains. This region contains seven internal repeats.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17727.1	0.0	9	596	7	594
ADL50077.1	9.93e-254	1	595	1	602
ADU23130.1	1.27e-223	1	596	1	602
QTE68365.1	2.65e-223	14	596	12	602
QUA54004.1	6.33e-222	11	595	9	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.64e-61	11	595	32	650	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.07e-57	11	529	32	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
3WRE_A	1.91e-07	76	488	81	520	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.93e-07	76	488	81	520	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	4.41e-07	76	488	81	520	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.05e-06	76	488	81	520	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001987_00080.