CAZyme Information: MGYG000001988_00034

Basic Information

• Species: Marvinbryantia sp900550755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900550755
• CAZyme ID: MGYG000001988_00034
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		92043.25	4.8105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001988	3989920	MAG	Spain	Europe

• Gene Location: Start: 44296; End: 46782 Strand: -

Full Sequence      

MKKVNIDGEWAFMLGEPSNIPGMQKESRMVNLPHDFMIESDVKADSINGTNTGYYNGAAG
TYTKYIDVPADWENQRVLVEFDGVFRDTSVILNGHIMGRHHYGYTPFRVELSNRLKWGKK
NRLAVLVSNDAEQNSRWYPGGGIYRHVNLLLAPQVHIAPDGIFAHTDHIVNGDAFVAVEV
TVENHTSQEQDLWVNIKLNKEEGAQDAAALGAIKVHIPANSSAVGRTTLCAENAVLWDID
HPDLYVVTAELVNRRPIDQAEDMVVLDSEKTLFGIRTISVDAKNGFMLNGRSLKLKGGCI
HHDNGILGAASLYESEYRKVKLHKENGYNALRFAHNPMSADLLEACDRLGILVMDEAFDT
WHMPKNRHDFCRHFEAEWKQEMKSFMTRDRNHPSVIIWSIGNELPEQGGLSDGYQTSAEL
AEYARSLDPTRFIGGAMCSFFNGLDDEDTGKFWESLMEAAMASGGVLNNLDGEYGRRIWN
DYTESFCAPWDVVGYNYLDYHYEEAGKLFPNRVICATESKPFQMEEYWADVEKYPYLIGD
FIWTSQDYIGEAGIGNVIYAEPEEAKAAAQRLNFVQYPWRTSGGGDFDLCGFEKPQLAYH
RIIWGSDETYIACHNPANFHKVELLGRYGWADCANSWTWDAQAGCDIKVEVYSSAEEVEL
FINGVSAGRQAAGRGNHNKVCFTVKYEPGTLEAISYTGGQEVSRDCVKSAGAPAGLKITA
DKRALCQDVLKADGQSLCFAIIEVVDDEGNTIPYAETEVCAKVEGAAALAAFGTGRPVTE
ENYTIGKAASYHGKMLAIVRSGYEKGTAKLIVSSEKLTGAELEITITE

Enzyme Prediction     

No EC number prediction in MGYG000001988_00034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	574	6.6e-106	0.6143617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.86e-64	7	548	16	502	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.41e-38	62	431	69	443	beta-D-glucuronidase; Provisional
PRK09525	lacZ	4.16e-31	60	436	122	492	beta-galactosidase.
PRK10340	ebgA	2.75e-30	59	433	110	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	1.62e-28	716	823	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG98217.1	0.0	1	826	1	812
QUL57111.1	0.0	1	828	1	814
AHF25051.1	8.85e-234	1	824	3	818
AHF25955.1	1.40e-230	1	822	1	829
AHF24670.1	4.90e-228	4	826	1	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	2.75e-142	1	827	5	776	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	2.99e-142	1	828	5	777	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	1.59e-115	1	827	1	802	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	1.24e-109	4	826	28	820	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	1.96e-107	2	806	8	787	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.62e-119	2	828	43	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.75e-88	3	814	48	808	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	7.84e-41	62	769	60	693	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	1.49e-39	5	811	30	780	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	2.73e-36	3	668	53	673	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001988_00034.