CAZyme Information: MGYG000001988_00592

Basic Information

• Species: Marvinbryantia sp900550755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900550755
• CAZyme ID: MGYG000001988_00592
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840	MGYG000001988_4|CGC6	97267.78	4.9552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001988	3989920	MAG	Spain	Europe

• Gene Location: Start: 117895; End: 120417 Strand: -

Full Sequence      

MVNLNSGWQLHESRLDVDKNQWASVLAQKEGWYDCSLPADVRMPLLENGVIKEPLKADYC
FESEWIEKRAWWFKKEFDSAEVDFDDDIIQLILEGLDSRADIFVNGNYIGTHVSVHYPFV
YDIKGLLVEGTNTILVRVTTGLEEVTDKDLAELNYAVCTEYDNGGKYRSDKRRAFVRRPQ
YTVGWDWGPKVVSCGITGGARLEGHRQIALREVYVQTVEAAETAKLKIMLNIENLGFISS
RTGAYKIRISYDGKTVYERSCSDVLLTSGYNYIEEEAVIENAQLWWPNGYGSQPLYDVEV
EASCNGATEHWHKMRYGIRTISIDTSVISGEDRKFEFLVNGKKVFCKGGNWIPNDFIYAR
VTDEKYRVLIDEAIEANFNMLRIWGGGLYERDLFYELCDEKGIMLWHDFMFACATLPDHR
QQFREEIRREFDYQTKRLRNHCSLAVFCGSNEVHWLFNHLDNPRWGIEFSYEHAYGMSLM
NILAKEIIHANCPSVAYWNSSPYGGERPNDNSLGDIHHWNCAFMSHKMEERIEAKDYDKI
GAKFVSEYGYVGPCCRETIEEYMDGQPLDRSSKLWWWHSNVFEKGTVHTAIEKNYVDHAD
ELSLDDYITYGGLVHGLMYGYSLESMKFKEHCYGGLIWMYNDAWGEVGWTIIDYYLRRKI
PFYAVKRSLAHRKFAMRVVDGDVVLQGINDLPETMEVTGRFGWISFDGKEQELRDVSFRM
EAGERTYLLREKLPQKDFTKGTMVLYVDSPEIANAWLRMDDMRKLAVPEADVTCLEDRRE
GDDRIIRVTCNTFAHAVHVDGNWKCSDNYFDLLPGEEKTFTVKDAGENALTVSAVNWQSM

Enzyme Prediction     

No EC number prediction in MGYG000001988_00592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	724	3.9e-79	0.6795212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.87e-54	4	739	15	704	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	6.03e-08	778	840	9	76	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	6.12e-07	208	319	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	6.10e-05	72	138	68	133	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PHA03231	PHA03231	1.40e-04	154	190	248	283	glycoprotein BALF4; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW77011.1	0.0	2	835	4	837
QIB55134.1	0.0	2	835	4	837
QBE99829.1	0.0	2	835	4	837
QBE97186.1	0.0	2	824	4	824
QGQ95120.1	5.85e-259	2	826	3	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	6.62e-116	11	814	20	802	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.56e-93	22	818	15	812	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.66e-93	22	818	17	814	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.72e-93	22	818	17	814	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	6.98e-93	22	818	15	812	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	9.96e-81	4	823	9	827	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1D911	4.92e-79	4	823	9	829	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
A1CGA8	1.78e-78	4	669	9	653	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	4.52e-78	3	669	8	651	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	4.41e-77	4	823	9	829	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001988_00592.