CAZyme Information: MGYG000001988_00846

Basic Information

• Species: Marvinbryantia sp900550755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900550755
• CAZyme ID: MGYG000001988_00846
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		63096	5.2905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001988	3989920	MAG	Spain	Europe

• Gene Location: Start: 79665; End: 81386 Strand: +

Full Sequence      

MLDLAKRPFYLNAEQIHWVKDTLAHLTTEQKAGQLFCVMGGDYEKDELKELVKKSRVGGI
LFRPAPAEEICENYRLLDEVAPVPLLKAANLEEGGAGATTDGTLFGWPMMVGAANDDGMV
EKFGKVCAAEGQSVGVNWTFSPVCDIDMNYRNPITNVRTYGSDKEKVKKNTQIYVEAVQK
CGVAACAKHFPGDGVDYRDHHLHPTYNSLSAEEWYGSYGAVYQNLIEHDLLSIMVGHIVQ
PAVQMEINPKLSFADCLPASQSRELLTGVLREKFGFNGVITTDATIMGGYCMAMERRKAI
PASVMAGCDMIVFNTNLYEDYSYILEGLKTGLLTEERLDDAVTRILALKAKVCGAGKDRT
YTGLSIDGNGACIGNAQEHSAGAQDMSLAQAAGWHRECADKSVTLVKSLAPRVLPVTKEK
YPQIRLITLGKDEIPGGSMAETAIELLRQRGFAVEHYQPFADDLHGCADLPKNRLTLYLA
NYEQASNQTTVRINWCPKHALDSPRFLNEEDCIFVSLANPYLLQDVPRVKTYINAYTATK
TTIETVIEKLTGESEFKGISPADAFCGLPDTRI

Enzyme Prediction     

No EC number prediction in MGYG000001988_00846.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	83	312	4.3e-46	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	1.20e-61	27	348	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	7.48e-56	26	440	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	7.97e-22	124	311	103	277	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.00e-15	19	349	38	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK28469.1	1.37e-210	1	573	1	546
SQG80074.1	1.37e-210	1	573	1	546
AQP42770.1	1.37e-210	1	573	1	546
CBZ48796.1	1.37e-210	1	573	1	546
CBI14087.1	1.37e-210	1	573	1	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	1.83e-145	4	573	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
6K5J_A	6.65e-38	26	562	11	529	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.16e-33	46	450	75	479	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	8.14e-33	46	450	49	453	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	9.83e-33	46	450	79	483	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	4.95e-134	1	573	1	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	1.18e-32	46	450	75	479	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q02PG9	7.08e-21	33	310	3	271	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=nagZ PE=3 SV=1
B7UYS5	7.08e-21	33	310	3	271	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=nagZ PE=3 SV=1
Q9HZK0	7.08e-21	33	310	3	271	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001988_00846.