CAZyme Information: MGYG000001988_01073

Basic Information

• Species: Marvinbryantia sp900550755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900550755
• CAZyme ID: MGYG000001988_01073
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817		88658.56	4.7732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001988	3989920	MAG	Spain	Europe

• Gene Location: Start: 16140; End: 18593 Strand: -

Full Sequence      

MEIYKDKNQTTEARVEDLLSRMTLEEKAAQLCGDLAAAFIVDGKVDINALREKFPDGHGR
FTQYSLVGLVDPVQIAEISNQVQEYFVKETRLGIPVALQTENLCGYPAAGGTLFPAMINM
GCTWEPSLAEKMSAIIGQESRSVGISSAMSPVIDVSRDPRWGRTYECFGEDPYVVSQFGI
HYVRGMQEQGVSCIAKHFLGYAETQGGLNTAAARLNDRELYEVFATPFEAADKEAHLGGM
MANYGEIDGLPVIDNPKIARTLLRDTMGFKGMLTSDGAAVLKTYNYFKIAKSYEEAGLLA
KKGGCDTEIPVGAAYKHLPEYVRSGELDEALLDESVRRILTIKFETGLFENPYCDVEKVK
EAMNNAQKNALSREIAEKSLVLLKNDGMLPLKQGAKVAVIGPHADNLRYPVSGYTYPAYI
EMLTAGASGQQTSFNGIADEQAKLEAESEEPGKKKVKGPFAAMYEMFSDDDRAKLGDMNS
VLRGMGAHSLREMLARRAEVVYAQGCDIIGESKDGFAEAVRAAEEADVVIMALGGNSGWV
NVTGGEGKDRQFLDLPGVQQQLLEAVTAVGKPVAVVLYGPGVFAVNWAQEHVSAILQAFM
PGQFAAEAVTKVLYGDVNPGGKLTMSVPRSAGQIPVYYNHKNGSGYQSGADTGTGSGIFS
GGYVDGACDPLYKFGYGLSYTDFEITDLQLENTEVPTDGMIEASCRVKNVGALAGDEVVQ
LYTSFFGAHVTRPNMQLAGFQRVSLKPGEEATVKFHLNTAQLGYYNEYMEFVVEPGDLTI
MAGNSSDHLTERRLVKLTGKAVNVMGRRAYTCKSEIA

Enzyme Prediction     

EC	3.2.1.37	3.2.1.55	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	88	309	1.1e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.36e-136	9	793	32	761	beta-glucosidase BglX.
COG1472	BglX	5.26e-74	22	416	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.64e-62	23	342	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	3.90e-61	65	784	55	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.99e-43	380	680	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT49116.1	0.0	1	816	1	816
QQA37498.1	7.53e-317	1	816	1	804
SNU95883.1	5.15e-300	3	816	5	808
AFM44649.1	5.95e-209	3	816	10	788
ABY95679.1	5.22e-203	3	804	4	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	2.28e-123	4	789	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.74e-122	4	789	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.49e-119	4	794	36	782	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	7.10e-113	15	797	14	753	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.81e-112	15	797	14	753	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH9	1.70e-124	4	786	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	1.05e-118	77	800	49	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	6.26e-104	10	786	30	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.44e-102	10	786	30	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
P14002	8.92e-81	91	816	34	684	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999653	0.000356	0.000011	0.000002	0.000001	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001988_01073.