CAZyme Information: MGYG000001988_02093

Basic Information

• Species: Marvinbryantia sp900550755
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900550755
• CAZyme ID: MGYG000001988_02093
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	MGYG000001988_19|CGC1	69623.24	7.4752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001988	3989920	MAG	Spain	Europe

• Gene Location: Start: 22386; End: 24212 Strand: +

Full Sequence      

MEALKKLKWYNVKKGLRYLKHFGVKEFLIRLQERMEPEEVPYGPWYEAYRPTESALAAQR
RKKFKNSWKFSIAVPAYETPETFLREMIKSVQGQTYDNWELCIVNASPENDVMRRVLAEY
SQKDARIRVKELAENKGIAGNTNEALAMASGDFVGLLDHDDLLAPNALFEAAKALEQEPS
IDVLYTDEDKVDTDGKKHFKPNLKPDFNLDLLRSNNYICHFFMVRRTLAEQAGGFSGEYD
GAQDYDFILRCTDMAKNIHHIPEILYHWRTHEASTADNPISKLYAYEAGKRAIEAHLTRR
GQAGEVSLKKDLGFYRVKYPVQGNPLVSVIIPNKDEAESLKLCIESLRRTVSWGNYEIII
VENNSTGPEIFSYYRELAKDARIRIVRWKSAFNYSAINNYGVKYAKGEYLLFLNNDIEAL
EEGWFTEMLGVCQRPEVGAVGAKLLYPDGTIQHAGTVIGIGGIAGHMFVNMPGGRSGYLH
KASLMLDYSAVTAACMMMKRSLFEQLGGFEERLSVAFNDVDLCLRANEAGNLVVYDPYAC
LRHYESKSRGAEDSPEKVRRFQEEIEFMRTRWEKLLKAGDPYYNKNLSLSKWNYSLRADR
KRGRNTND

Enzyme Prediction     

No EC number prediction in MGYG000001988_02093.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	71	230	7.6e-26	0.9764705882352941
GT2	328	506	4.2e-22	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	9.36e-105	69	270	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.15e-40	329	545	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	4.12e-31	83	275	12	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.24e-25	323	604	1	285	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.01e-25	71	226	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE99393.1	7.21e-305	4	599	12	607
QIB58022.1	2.06e-304	4	599	12	607
QMW77454.1	2.06e-304	4	599	12	607
QQQ92271.1	2.39e-303	4	599	12	607
QJU15221.1	3.20e-303	4	599	20	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z87_A	8.57e-15	71	276	377	578	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	8.59e-15	71	276	378	579	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.53e-140	62	600	360	901	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.14e-120	37	597	288	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	5.57e-18	71	286	11	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q9CMP0	3.66e-14	71	276	436	637	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q7BLV3	3.67e-14	71	276	443	644	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001988_02093.