CAZyme Information: MGYG000001993_00597

Basic Information

• Species: Collinsella sp900754275
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900754275
• CAZyme ID: MGYG000001993_00597
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	MGYG000001993_11|CGC1	70704.07	7.2065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001993	2092787	MAG	Spain	Europe

• Gene Location: Start: 19259; End: 21250 Strand: -

Full Sequence      

MIGIGIDIGSTAAKAAVVDGEGSVAWTCVQPTGFSSVDASERLREALAAAGYDVTADDAR
VIATGYGRVAVPYAHKVVTEITCHGTGAVRLFGDHGTVIDVGGQDTKVIQLKSGRVAKFA
MNDKCAAGTGRFLEIMADRLGISQQQMADLARSGEPTKISSMCTVFAESEVISLIGRGEP
RENIARGVIESVARGHYGRAGGGRPVLPDRWPVRERLRGGAVGRATGVAGDHLAPGSLCR
SDRRGCPRRRFGLGVYRDMRILNITAQKPDSTGSGTYLAALVREQIETGHRAAVLCGAAP
GDTQGELDRRAAVFAVPFESPELPFPICGMSDVMPYPSTRYRDLTPSMLKAFERAFAAAI
DRAVAEFRPDLVLCHHLYLVTALARECVRGVPVVAVCHSTDLRQLRSHTLERDRIVRAVR
RLDAVFALHAEQAEQIGLVCGVDADRIHVIGTGYDHRVFCRDASVARRPGSLVYVGKICF
KKGVESLVRAMSLPIDDGVRPSGLVLVGGRGDDAEYARIERLAAASDVPVTLAGRLDSDG
LVRAYRSSDVLVLPSFYEGLPLVTIEALACGCKVVATDLPGVRPWMEAMLPGAPVTWVAS
PRMTDVDTPVAADLPLFERALADAIAQALADPPSTFEPSAVSWEACLGRILKVVDLLEGG
SYG

Enzyme Prediction     

No EC number prediction in MGYG000001993_00597.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	472	586	5.7e-19	0.7

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00241	CoA_E_activ	1.02e-61	2	194	1	192	CoA-substrate-specific enzyme activase, putative. This domain is found in a set of closely related proteins including the (R)-2-hydroxyglutaryl-CoA dehydratase activase of Acidaminococcus fermentans, in longer proteins from M. jannaschii and M. thermoautotrophicum that share an additional N-terminal domain, in a protein described as a subunit of the benzoyl-CoA reductase of Rhodopseudomonas palustris, and in two repeats of an uncharacterized protein of Aquifex aeolicus.This domain may be involved in generating or regenerating the active sites of enzymes related to (R)-2-hydroxyglutaryl-CoA dehydratase and benzoyl-CoA reductase.
COG1924	YjiL	1.85e-60	1	209	135	345	Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid transport and metabolism].
pfam01869	BcrAD_BadFG	2.93e-41	4	194	1	208	BadF/BadG/BcrA/BcrD ATPase family. This family includes the BadF and BadG proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis. The family also includes an activase subunit from the enzyme 2-hydroxyglutaryl-CoA dehydratase. Aquifex aeolicus aq_278 contains two copies of this region suggesting that the family may structurally dimerize. This family appears to be related to pfam00370.
cd03801	GT4_PimA-like	4.22e-37	260	633	1	335	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03798	GT4_WlbH-like	1.93e-34	271	653	13	372	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY60222.1	1.69e-153	259	652	1	398
SDR86382.1	2.55e-140	259	651	1	390
BBH49919.1	8.85e-140	259	658	1	403
AJC11552.1	2.74e-128	259	661	1	406
QKF07020.1	4.73e-110	221	651	9	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HUX_A	8.43e-35	4	193	6	196	CrystalStructure Of The Acidaminococcus Fermentans (R)-2- Hydroxyglutaryl-Coa Dehydratase Component A [Acidaminococcus fermentans],1HUX_B Crystal Structure Of The Acidaminococcus Fermentans (R)-2- Hydroxyglutaryl-Coa Dehydratase Component A [Acidaminococcus fermentans]
4EHT_A	1.44e-32	1	194	1	195	ChainA, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EHT_B Chain B, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EHU_A Chain A, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EHU_B Chain B, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile],4EIA_A Chain A, Activator of 2-hydroxyisocaproyl-CoA dehydratase [Clostridioides difficile]
6KIH_A	6.34e-15	472	649	247	398	Sucrose-phosphatesynthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_B Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_C Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_E Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_F Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_G Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_H Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_I Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_J Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_K Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus],6KIH_L Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus [Thermosynechococcus vestitus]
6TVP_A	3.38e-12	390	647	115	380	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]
3C4Q_A	2.05e-06	443	581	186	339	Structureof the retaining glycosyltransferase MshA : The first step in mycothiol biosynthesis. Organism : Corynebacterium glutamicum- Complex with UDP [Corynebacterium glutamicum],3C4Q_B Structure of the retaining glycosyltransferase MshA : The first step in mycothiol biosynthesis. Organism : Corynebacterium glutamicum- Complex with UDP [Corynebacterium glutamicum],3C4V_A Structure of the retaining glycosyltransferase MshA:The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum : Complex with UDP and 1L-INS-1-P. [Corynebacterium glutamicum],3C4V_B Structure of the retaining glycosyltransferase MshA:The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum : Complex with UDP and 1L-INS-1-P. [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39383	3.05e-37	4	194	5	191	Uncharacterized protein YjiL OS=Escherichia coli (strain K12) OX=83333 GN=yjiL PE=4 SV=2
G3KIM5	1.87e-34	1	193	1	194	Activator of lactoyl-CoA dehydratase (Fragment) OS=Anaerotignum propionicum OX=28446 GN=lcdC PE=1 SV=1
P11568	3.59e-34	4	193	6	196	(R)-2-hydroxyglutaryl-CoA dehydratase activating ATPase OS=Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4) OX=591001 GN=hgdC PE=1 SV=2
Q60315	1.00e-32	4	192	3	186	Uncharacterized protein MJ0004 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0004 PE=4 SV=1
Q93AM0	1.24e-32	4	193	7	197	(R)-phenyllactate dehydratase activator OS=Clostridium sporogenes OX=1509 GN=fldI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001993_00597.