CAZyme Information: MGYG000001995_01087

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_01087
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	MGYG000001995_11|CGC2	76740.2	5.3219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 41136; End: 43190 Strand: -

Full Sequence      

MNTKNLLIAGMFAGLFLSCKEVEPPAPVLPVPTSEQIEWQKMENYAFVHFGLNTFNDLEW
GYGNTPAETFNPTDLDCEQWVRIIKAAGLKGVILTAKHHDGFCLWPTQTVDYNISNSPYK
NGKGDMVRELSDACKKHGLKFGLYLSPWDRHNAEYGREGYQKTYHEQINELISNYGPLFE
FWFDGANGGNGWYGGTNETRSIDPKTYYGYETAREMIKAKHPEAMIFGGTVPDIRWIGNE
SGWAGETNWSSYSLDKETHYTQNQWGMKDGSQWLPGECDVSIRPGWFYHHREDHQVRTVP
NLVDLYYRSVGHNANFLLNFPIALSGQIHPVDSARAVDWYHTIQTELKDNLLAGVKPKAS
ETRGSAYKASNVTDDSWDSYWATSDGVTSGSLTFPLPAGTSLNRVMIQEYIPLGQRVCAF
MLEVEKDGKWLPVEIADTLSTVGYKRIVRFKTTSADALRINFTEAKGPLCINNVEAFLAP
PLLEQPCIVRNAKNEVRIGVESEGADIYYTTDGTEPTVQSAKYEAPFILDRKGTVKAITN
DAQSGKTGPVAIRNFDLPAADYKVISPVDEQTNLMFDGNGYSTYYLPEGKNEIIVEFPAP
HTISGFVYTPNQGRDSQGHISNYQLLIDGKVVVSGEFSNIKYNPIEQEIRFAPVRGQKIV
FKATRIVDNVKRVGIAEFSVITED

Enzyme Prediction     

No EC number prediction in MGYG000001995_01087.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	30	335	1.6e-74	0.846820809248555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	2.92e-53	25	466	4	419	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	1.49e-35	67	335	73	322	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	2.43e-34	59	335	69	320	Alpha-L-fucosidase.
pfam13287	Fn3_assoc	1.69e-13	496	547	1	54	Fn3 associated.
pfam13290	CHB_HEX_C_1	5.50e-13	495	551	11	66	Chitobiase/beta-hexosaminidase C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50347.1	0.0	1	684	1	684
QUT97698.1	0.0	1	683	4	685
AST55451.1	0.0	1	683	4	685
QJE29484.1	0.0	1	683	4	685
QIX64728.1	0.0	1	683	4	685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	2.86e-147	1	666	11	570	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	1.56e-110	26	485	4	462	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	4.83e-105	31	680	31	582	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	1.45e-94	32	461	19	460	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	1.68e-92	32	461	19	460	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	1.32e-101	1	467	1	466	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	1.35e-101	25	450	31	449	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
P49713	6.14e-11	55	335	74	334	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
P17164	1.02e-10	39	335	77	350	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q2KIM0	5.56e-10	67	445	115	468	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000025	0.004238	0.995732	0.000002	0.000004	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001995_01087.