CAZyme Information: MGYG000001995_01201

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_01201
• CAZy Family: CBM62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650	MGYG000001995_12|CGC4	75068.28	6.9153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 84269; End: 86221 Strand: -

Full Sequence      

MKLYLIIFFAFCLFSCSWQGNKNTYLEQALSLAGNNRKELEKVLNHYQADTLKLKAAQFL
IENMPYYYYYTGKTLDRQMEQYKLFATTDQHPASIRDSLALKYGPFSYSALNMEYDLLNV
DSAYLVENIDEAFRVWEEQPWGKHVSFENFCEYILPYRTGDEPLTYWRKQIYEKYNPLLD
SIRKLPEAEDPAFAAQALLDTFRREGNIKYTEQLAITPHTGPQVCVEWKSGTCREHADAV
IYVMRALGIPCGIDEVPLRGDNNSPHMWNFVLDKEQNTYMIEILTYSEIRKAPEVYLSAG
KIYRHTFSTNNSLKEQFNASGLPVPSYFRTGQIKDITKIYAGSGCFPVEISGTKLYKRIK
KSEPIWLCLSARQQWKPVDYGYLLENKVCFKDVKGGVVCRLAHSTKEGLEMLSDPFHVDA
EHGTIRFFTPGQEMEQVTVLFKFHFFYEYFLNRMVNGIFEGSNAPDFSHADTLFQIKDEP
RRLITVVSPATDKKYRYVRYKGPKGSHCNISEVAFYENNVDTVALKGKVIGTPGSFDGIH
DYRNVFDGNPYTSFDYRFPDGGWSGLDLGKACSIARIAFTPRNSDNFIRKGDSYEMFYLD
HEWVSAGIQTAVSDSLNFMAPKGALLYLKNHTRGKDERIFEYKEGKQIFW

Enzyme Prediction     

No EC number prediction in MGYG000001995_01201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM62	449	517	4.1e-23	0.5267175572519084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01841	Transglut_core	2.99e-07	188	269	11	94	Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.
smart00460	TGc	1.45e-04	229	269	5	53	Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH87132.1	9.52e-215	3	650	11	653
QDO67716.1	3.83e-214	22	650	23	653
QDO68297.1	5.02e-212	1	650	10	653
QCQ50079.1	1.11e-211	13	650	25	656
QUU03539.1	9.29e-210	15	650	24	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YB7_A	8.37e-09	453	516	73	137	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YB7_B Chain B, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFU_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFZ_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YG0_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
5G56_A	7.28e-07	453	516	774	838	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000045	0.999996	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001995_01201.