CAZyme Information: MGYG000001995_01523

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_01523
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	MGYG000001995_17|CGC2	50595.2	6.8667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 45538; End: 46917 Strand: +

Full Sequence      

MKKENSISRRSFLKSSAMAGALGAIGGGSASVLTSCSGGGAENSTNKPLKEPGTYYIPEL
PDKAADGKELKAGVIGCGGRGSGAAFNFLEAANGVTIVALGDTFKERVDGLANDLKEKGI
DIPADKRFVGLDAYKQVIDSGVDVLIIATPPVFRPVHFQYAVEKGKHCFLEKPICVDPVG
YRTIMATAKQAQAKNLCVVTGTQRHHQRNYVESYKKIMEGAIGEITGGVVYWNQNMLWFN
ERKPGWSDCEYMIKDWVNWKWLSGDHIVEQHVHNIDVFTWFSGLKPVKAVGFGSRQRRIT
GDQYDNFSIDFTMENGVHMHSMSRQIDGCVNNVSEFIQGTKGSWSTANDETVIKDNAGNI
IWKYDKEAEKNEHQQNNPYVLEHVNWVNCIRSNKPIEQASETAISNMAAIMGRESAYSGA
ETTWEAMTASPLDYTPKDLNLGKMDMSTFTVPVPGKPRD

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	68	240	4.8e-16	0.42105263157894735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.41e-37	67	419	1	335	Predicted dehydrogenase [General function prediction only].
TIGR04380	myo_inos_iolG	4.59e-12	69	395	1	301	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
pfam01408	GFO_IDH_MocA	4.08e-10	70	194	1	115	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
cd00300	LDH_like	4.21e-04	73	155	2	80	L-lactate dehydrogenase-like enzymes. Members of this subfamily are tetrameric NAD-dependent 2-hydroxycarboxylate dehydrogenases including LDHs, L-2-hydroxyisocaproate dehydrogenases (L-HicDH), and LDH-like malate dehydrogenases (MDH). Dehydrogenases catalyze the conversion of carbonyl compounds to alcohols or amino acids. LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Vertebrate LDHs are non-allosteric, but some bacterial LDHs are activated by an allosteric effector such as fructose-1,6-bisphosphate. L-HicDH catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
TIGR01299	synapt_SV2	7.16e-04	280	318	467	506	synaptic vesicle protein SV2. This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT51053.1	4.09e-308	1	459	1	457
ABR45528.1	1.36e-292	1	459	1	458
QRO18095.1	1.36e-292	1	459	1	458
BBK93797.1	5.55e-292	1	459	1	458
QIX65768.1	5.55e-292	1	459	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CEA_A	2.35e-10	68	294	7	210	ChainA, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]
3E18_A	4.25e-07	68	343	4	247	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
4N54_A	1.72e-06	68	293	13	215	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4MKX_A	1.74e-06	68	293	16	218	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4FK61	2.16e-06	68	223	4	148	Inositol 2-dehydrogenase 4 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=iolG4 PE=3 SV=1
Q01S58	8.69e-06	8	255	5	229	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.004004	0.996013	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001995_01523.