CAZyme Information: MGYG000001995_01905

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_01905
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43200.87	7.9674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 24335; End: 25495 Strand: +

Full Sequence      

MKTFYKTLCIFIVNYLVITPTLYAQISFEKKNEVAVFISGEEGYKSFRIPAIIRIPNGDL
LAFCEGRVDHAGDFGHIDLVMKRSKDYGNSWSKLQVVARNGKLQACNPAPVLDLIDSRFP
AGRLFLFYNTGNVPEADILSGKGDKRCWFITSVDGGESWSEPTDITSSVKKAGWRYYANT
PGHAIQIQNGPYKGRIYVAANHSFGNPQPYGKHYQAHGYYTDDHGKTFHLSTDIAYAGSN
ESMVAELSNGKLMMNSRNQQGNVKARLISLSNDGGKTWESPYFDPVLIDPVCQGSILSLG
ERNGQTMLAFCNAADTLHRNNLTLRISFDEGKSWIKDFLIYGKTQDKQSIDYAAYSDLVQ
IADKQIGVLYEKDNYKTIEFTAISFK

Enzyme Prediction     

No EC number prediction in MGYG000001995_01905.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	33	381	7e-89	0.9707602339181286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	5.66e-107	34	384	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.07e-38	58	368	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	4.69e-06	90	374	434	703	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	2.53e-04	152	343	6	176	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
cd00260	Sialidase	6.79e-04	43	197	11	171	sialidases/neuraminidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates as well as playing roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed beta-propeller fold. This hierarchy includes eubacterial, eukaryotic, and viral sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC54482.1	2.07e-150	31	386	44	411
QRR01369.1	1.06e-146	28	386	15	384
AYD48371.1	2.72e-146	29	385	21	382
ATL46053.1	2.46e-144	27	385	19	381
ACT94235.1	3.61e-143	33	383	22	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	7.86e-33	38	371	16	344	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1W8N_A	1.30e-32	38	371	12	340	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]
1EUT_A	1.15e-31	38	371	16	344	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	3.87e-31	38	371	12	340	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	7.16e-31	38	371	12	340	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	7.64e-31	38	371	58	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
Q99PW3	2.50e-27	33	372	55	389	Sialidase-1 OS=Rattus norvegicus OX=10116 GN=Neu1 PE=1 SV=1
O35657	4.71e-27	33	372	55	389	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
Q4WQS0	2.20e-26	43	373	54	376	Exo-alpha-sialidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G13800 PE=1 SV=2
D4B4P1	2.26e-26	43	376	57	381	Exo-alpha-sialidase ARB_03431 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03431 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000980	0.998195	0.000256	0.000184	0.000180	0.000194

TMHMM  Annotations     

start	end
7	26