CAZyme Information: MGYG000001995_01918

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_01918
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	MGYG000001995_24|CGC3	64943.27	5.6674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 43274; End: 45028 Strand: -

Full Sequence      

MNKTLIFLSLFFITSVAFAGQRDSRVREYLSPVRIVWQQDGGQISGADNLLLPGNGQTDL
ANQNICKIVSTDELHPAILLDFGKELQGGLQIVTGMPGSQKPINIRVRFGESVSEAMCEI
DGKNGASNDHAMRDFTISLPWLGVMEVGNSGFRFVRIDLLDENTELQLKEVRAISTFRDI
PYKGSFRCNDERLNRIWQTGAYTVHLNMQEYLWDGVKRDRLVWVGDLHPEVMTVNTVFGY
NEVVPKSLDLIRDITPLPQWMNGISSYSIWWLLIHRDWYYYQGDQAYLKAQQPYLTALLR
HLISKVENGREKLDGNRFLDWPSNANPVAIDAGLQALMVQAMKAGDELCSVLGDEALAKE
CRTTGEKMVKASSAVTKALLKSKVAPDAPGSKQAASLLALAGLMDPNKADKEYLSVNGAN
GFSTFYGYYMLRAMASAGNYKGALDIIREYWGAMIDLGATTFWEDFNMEWLPDAAPIDAL
VPAGKKDIHGDFGAYCYKGFRHSLCHGWASGPTSWLSEYVLGVQVVEPGCKVVRVTPHLG
DLKWVEGTFPTPYGVINIRHEVGVDGKIISTVKAPDEVQVILPE

Enzyme Prediction     

No EC number prediction in MGYG000001995_01918.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	77	580	2.6e-104	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.42e-16	184	474	4	320	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.51e-06	522	583	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48045.1	0.0	1	581	1	582
QUR50485.1	0.0	1	580	1	580
QUT19201.1	0.0	1	580	1	580
ABR43079.1	0.0	1	582	1	582
QRO16730.1	0.0	1	582	1	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.67e-49	68	558	184	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	5.58e-17	77	521	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6GSZ_A	1.02e-11	79	583	329	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999078	0.000169	0.000166	0.000166	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001995_01918.