CAZyme Information: MGYG000001995_02650

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_02650
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000001995_40|CGC1	33066.61	6.6057

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 33160; End: 34020 Strand: -

Full Sequence      

MINKVFFYLILCFLVNFTGFAQGTVMESLSFQSDKLGKKVAYSIYLPEDYNTSQRTYPVL
YLLHGYSDNETNWVQSGQVKTIADKAIANETAVPMIIVMPDAWDTWYVNQYDGKAPYEDM
FFEELIPYMEKTYRIRSTKESRAIAGLSMGGYGSFLYSLHHPEMFSACAPLSAAVFDDNV
MKARQSNSHKDLYFRLFGPGLEYWKKNSVLQILSESNENNLPRVRYYIDCGDDDYLLEGN
FQVHKLMQGKKIPHEFRVRDGGHSWSYWRSALPEVLKFVSLSFSRS

Enzyme Prediction     

No EC number prediction in MGYG000001995_02650.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	281	5.7e-61	0.986784140969163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	9.02e-41	18	278	61	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	3.10e-40	33	278	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.08e-38	40	279	35	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG4099	COG4099	2.73e-09	28	172	162	301	Predicted peptidase [General function prediction only].
COG2819	YbbA	1.73e-07	26	280	9	259	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMQ56447.1	8.21e-34	31	272	148	377
ABF40860.1	1.11e-33	31	272	149	374
BCS34250.1	2.11e-32	31	272	110	335
QJW99051.1	3.11e-32	27	275	276	501
AKD58571.1	5.70e-32	22	276	137	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	7.21e-53	33	285	19	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
4RGY_A	4.25e-28	31	281	9	263	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
6RZN_A	1.43e-25	22	274	129	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	4.30e-24	19	279	26	257	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.16e-23	19	279	26	257	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	1.47e-23	44	276	449	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	4.49e-22	19	279	45	276	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	1.60e-20	26	176	500	657	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	1.57e-19	31	263	179	425	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	1.57e-19	31	263	179	425	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.999057	0.000164	0.000145	0.000142	0.000139

TMHMM  Annotations     

start	end
5	26