CAZyme Information: MGYG000001995_03070

Basic Information

• Species: Parabacteroides sp900541965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900541965
• CAZyme ID: MGYG000001995_03070
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	MGYG000001995_54|CGC1	98183.74	4.9324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001995	4648473	MAG	Spain	Europe

• Gene Location: Start: 1359; End: 3965 Strand: +

Full Sequence      

MKKKYFMAGILAMFFISSCNENPQKYPFQNPDLPVDERIDDLLSRLTPEEKIGQMMNNTP
AIERLGIPEYDWWNEALHGVARAGQATVFPQAIAMAATFDDEALLKTFTMVSDEARAKYH
QYQRNKEYDRYKGLTFWTPNINIFRDPRWGRGMETYGEDPYLTERMGLAVVKGLQGDNPK
YFKTHACAKHYAVHSGPEWNRHEFDVDVTPRDLWETYLPAFEALVKEGNVQEVMCAYNRF
EGKPCCSSDKLLIDILRNSWGYENIILSDCGAINDFWERDPNTPRHETHPDAETASADAV
LSGTDLECGNSYRSLKKALQDGKITEKDLDVSLRRVLKGRFELGMFDPDERVPYAQIPYS
IVECPEHVSQALEMARKSMVLLKNRNNTLPLSKNLKKIAVVGPNAMDSTMLWANYNGFPT
HTVTILEGIRNKMPNAEIIYELGCNHTNDFVMKDLGEYISSPAGQGFASEFFNNTNFEGD
AVYKGNSRELHYTTGGNTQFAPNVNLTNFTARFTGEFEAPETTPVEFKLSGNDAFRLFIG
EEKVAEVWENEYGAERTYTLHAEKGKKYPVKIEYMQRAGSADLNLSVGTRQPVDYTATAD
KVKDADVILYVGGISPRLEGEEMPVDADGFKKGDRLNIEIPKVQQKMIKALESTGKPVVY
VLCTGSALALNWEDENVDAILNAWYGGQEAGTAVADILFGDYNPAGRLPITFYKSIDQLP
DFQNYNMKGRTYRYMTQKPLYPFGYGLSYTSFDYQDAKLSFNKIKKDESVTLTLNIANTG
EMDGDEVVQIYIKNPNDPAGPIKTLKAFKRVNIQAGDTQKTSFELEPETFWSFNDKTQTM
EVRPGKYQILYGGSSDDKALKSIQLIIE

Enzyme Prediction     

EC	3.2.1.37	3.2.1.-	3.2.1.21	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	308	4.9e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.10e-142	27	857	23	756	beta-glucosidase BglX.
PLN03080	PLN03080	1.27e-124	10	833	8	750	Probable beta-xylosidase; Provisional
COG1472	BglX	9.28e-75	54	433	47	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	8.51e-57	379	749	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.03e-44	64	337	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48944.1	0.0	1	868	1	868
QUT19023.1	0.0	1	868	1	868
QUT95269.1	0.0	1	868	1	868
AST53623.1	0.0	1	868	1	868
QCY56459.1	0.0	1	868	1	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TF0_A	1.64e-87	29	855	43	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
7VC6_A	1.86e-85	42	849	29	715	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC7_A	1.86e-85	42	849	29	715	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
5XXL_A	1.32e-83	43	857	60	743	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	6.71e-83	43	857	60	743	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY15	1.03e-270	11	867	7	861	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
Q9SGZ5	2.51e-108	20	854	30	759	Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BXL7 PE=2 SV=2
T2KMH0	6.53e-107	1	868	1	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.59e-99	30	866	63	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.09e-99	30	855	63	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001995_03070.