CAZyme Information: MGYG000001998_00883

Basic Information

• Species: Lachnospira sp900552795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp900552795
• CAZyme ID: MGYG000001998_00883
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		44017.96	4.578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001998	2300661	MAG	Spain	Europe

• Gene Location: Start: 125988; End: 127130 Strand: +

Full Sequence      

MDIIVKYIDELLEKSTPEAPMWNIEKLKQGMKSTWNYIDGCMIKAVLEMYAISKDEKYLK
FADDFIDYRVNEDGTIDGYNVGEKNIDNVNAGKTLFELYDITGKEKYRKAIDLVYSQIEI
MPRCESGNFWHKDIYPNQVWLDGMYMGQPFYMEYETRFNNRKNYDDIFSQFKFVIENLRN
PLNGLYFHAMDTSREAFWCDKVTGLSQLTWLRAIGWYSMSLLDTLDKVDNSDHKYDAECK
MLQDAYADLMESMIKYQDESGMWYQVVNYGGMDKNYLETSGSAIMAYSLFKGVRLGYLPE
SYAQYAEKAINGICDKYLNTSEGNMSLGGICLVAGLGGKGRRSGTYEYYMSEPIVEDDAK
GVGPFLLAYTELLRYKNKNN

Enzyme Prediction     

No EC number prediction in MGYG000001998_00883.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	374	2.7e-113	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.40e-92	23	374	22	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.00e-81	30	376	22	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71682.1	6.15e-233	1	378	1	381
CBL09353.1	2.67e-207	1	374	1	372
VCV21981.1	3.10e-206	1	374	1	372
CBL12002.1	4.41e-206	1	374	1	372
ABX40590.1	1.79e-205	1	374	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.25e-99	35	371	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.75e-63	22	372	28	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.27e-62	22	372	18	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	5.59e-13	35	313	65	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.40e-10	35	313	66	329	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.24e-62	22	372	28	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.28e-37	146	373	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.28e-37	146	373	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	3.21e-20	31	315	25	288	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001998_00883.