CAZyme Information: MGYG000001998_01387

Basic Information

• Species: Lachnospira sp900552795
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp900552795
• CAZyme ID: MGYG000001998_01387
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001998_9|CGC1	44080.92	5.2185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001998	2300661	MAG	Spain	Europe

• Gene Location: Start: 30486; End: 31607 Strand: +

Full Sequence      

MENRVFRRNWAVWMADTVLCKFPEVKKRWSYDYGVVCKGIEKVYELTGDQKYFRYIKDSM
DCFVQEDGNIKYYDMEEFNLDYVNNGKILLYLYEKTHEEKYAKASDILREQLNRQPRTSD
GGFWHKKMYPYQMWLDGLYMAEPFYAEYIKMFGKEKSYDDVVLQFSLIDKHSKDSRSHLL
YHGWDEKRQCFWADKETGLSANFWGRSIGWYSCALVDTLDYLENDKDREILINMVRDLAD
ALIKVRSKSNFLWYQVMDKENDYGNYPEASCSCMFTYFLLKAVRKGYIDDSYFDYAKKSY
YAIVREFIEVDQNALLNLRGTVYVSGLGGDKLRDGSYDYYISEPKQTNNLLGIGAFLMAS
AEMENTLANSGTP

Enzyme Prediction     

No EC number prediction in MGYG000001998_01387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	25	364	1.6e-113	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.33e-108	14	364	19	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.20e-103	10	367	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADQ05897.1	2.95e-145	7	364	9	370
ADQ41452.1	4.84e-144	7	364	9	370
AEM73046.1	1.96e-143	7	364	9	370
AEM72744.1	6.68e-143	14	364	1	355
ADL43392.1	6.44e-142	7	364	9	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	6.64e-120	14	364	8	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	9.65e-85	9	371	15	372	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.02e-84	9	371	5	362	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.67e-18	29	305	65	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.97e-13	29	330	66	351	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.29e-84	9	371	15	372	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.49e-34	140	362	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.49e-34	140	362	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001998_01387.