CAZyme Information: MGYG000002007_00136

Basic Information

• Species: Alistipes dispar
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes dispar
• CAZyme ID: MGYG000002007_00136
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000002007_1|CGC4	76797.04	5.5805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002007	2708946	MAG	Spain	Europe

• Gene Location: Start: 165946; End: 167970 Strand: +

Full Sequence      

MNRPFCILLACAFAASVPGAAAGASAPNYPNNRAPLAPKAYVELPLGAVRAKGWLGEMLE
RQRSGATGRMDELYPEVMGPRNGWLGGDGDQWERGPYWIDGLLPLAWLLDDAELKAKVRP
WIEWILRSQREDGYFGPATDYPGEFGLQRNNSADWWPRMVVLKILQQYYSATNDRRVIDF
MTRYFRYQLKTLPDKPLGHWSHWAVYRACDNLQAVYWLYNLTGDGFLLELGDLLHRQGHD
YTGMFLESDDLKRFNSIHCVNLAQGFKEPVIYYQRRPERRYLDAVKKGFSDLALLHGQPQ
GMYGADEGLHGGDPTQGSELCAAVEMMFSLEQMMGITGDVAFADRLERVAFNALPTQVTD
DFMYKQYFQQPNQVMATRHTRNFYEDAVHAQTDVVFGTLSGFPCCYSNMHQGWPKFAQHL
WFATPDNGVAALIYSPSEVTLRVGDGRTVTIAEQTAYPMEEEIRFSVRMAGRGGERFPFH
LRIPGWCEGAEVEVNGERVQSPGGGTIAVVEREWRDGDSLVLRLPMRVVTSRWYENSVSV
ERGPLVYALAMREEWELKRFPDAEVRQFGREYYEVTSPDAWNYGLPVRVADKPAENSRVE
VDAAKARSRYFWNYENAPVRIRVKAKRMPAWGLYNEMTGPLPYSVGTTPCPEEEVELIPY
GCSTLRVSEFPVVW

Enzyme Prediction     

No EC number prediction in MGYG000002007_00136.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	318	548	1.1e-35	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.38e-63	97	548	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.34e-32	111	549	84	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	3.55e-155	32	673	31	648
AMP98056.1	5.53e-154	29	673	28	651
QDW25584.1	1.40e-150	32	673	31	650
QPH39723.1	3.81e-150	32	673	29	649
ATP55412.1	4.25e-150	26	673	25	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	7.19e-21	98	549	82	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.85e-18	98	549	82	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	3.85e-15	315	549	377	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6EX6_A	2.51e-14	319	594	315	587	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000500	0.998692	0.000233	0.000208	0.000181	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002007_00136.