CAZyme Information: MGYG000002007_00212

Basic Information

• Species: Alistipes dispar
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes dispar
• CAZyme ID: MGYG000002007_00212
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002007_1|CGC6	43278.45	6.9183

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002007	2708946	MAG	Spain	Europe

• Gene Location: Start: 273932; End: 275071 Strand: -

Full Sequence      

MKRLLLLGLCLLLCPTGYASGKGKRLKAPEKTILKMVDPDATPETKALYANLWCIGLDGV
MFGHHDYPSYGIGWKGDKDRSDVKDIVGSHPAVYSLDMAGIDDTKIRHIQEAYKRGGVCM
LVWHQSNPLTEGPGKKYPVGTAWDNTKVVDRILQEGSPMNLKYKARLDDVAEAFRKMVDE
KGRPIPVIFRPLHEHTQTWNWWGRSATTDREFIAFWRFIVSYLRDTKDVHNVIYAISPQM
DAVYDDPVGRLLFRWPGDQWVDFIGMDCYHGRNTAAFESNVQAMVEVRGLRHKPVGITET
GLENDHKADYWTQDVLRVLRGEPCAMVVAWRNDNPRHAYGPYPSDASAEDFKLFDADEWT
LLERDLPDMYSMPKNVTVK

Enzyme Prediction     

No EC number prediction in MGYG000002007_00212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	37	306	1.1e-56	0.8448844884488449

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.16e-34	37	269	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	3.68e-10	162	314	159	307	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06293.1	1.13e-298	1	379	1	379
BBL01058.1	4.79e-238	1	379	1	377
ADF53787.1	4.29e-179	34	378	399	743
AGY53051.1	4.24e-127	61	378	1	323
BBL06287.1	2.96e-116	34	379	78	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VX5_A	7.28e-70	16	370	19	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	7.28e-70	16	370	19	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	1.35e-69	16	370	42	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	5.69e-69	16	370	19	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]
4ZXO_A	2.05e-67	40	372	7	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	5.20e-58	7	373	18	418	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	3.05e-34	15	373	25	406	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49425	4.33e-17	29	317	139	435	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
O05512	2.02e-16	62	269	63	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P16699	1.39e-12	38	270	36	271	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999104	0.000199	0.000147	0.000139	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002007_00212.