CAZyme Information: MGYG000002008_01500

Basic Information

• Species: CAG-115 sp003516865
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp003516865
• CAZyme ID: MGYG000002008_01500
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		39892.45	4.9182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002008	2115917	MAG	Spain	Europe

• Gene Location: Start: 17946; End: 18974 Strand: -

Full Sequence      

MRDFVGFKKGVNLGGWLSQCDYSENTLENFITEDDIKRIAGWGADHVRLPFDFNIIINEN
GEMKPDAFKYLDRAVSWTKKHGINIILDLHKTLGFSFDPGEKEAGFFSNEKYQDIFVNMW
VKIAEHFSGNDKNIAFELLNEITDDEFAEPWNKISRRAIEAVRKVAPHNYIIIGGIHNNS
IKGLSLMEKPFDDKIVFTFHFYDPLIFTHQKAYWVDGMPADFDMAYPAPTAEYVEKSKKF
PEKKVWEVFEGYAEDVVDARFLEFYMREAVCIAEKMNTPLYCGEYGVIEIAPLPDTLRWH
KDMRDVFNRLNIGRSVWVYKALDFGFMDDARRDIYDELTKLI

Enzyme Prediction     

No EC number prediction in MGYG000002008_01500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	324	7.6e-126	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.79e-27	30	216	24	209	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.82e-23	7	218	51	277	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61786.1	7.79e-117	1	342	1	340
CBL34054.1	6.99e-113	1	342	1	341
CBK95738.1	9.91e-113	1	342	1	341
AEV59739.1	1.07e-111	9	341	5	336
CCO06210.1	1.26e-110	1	342	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.03e-73	5	342	2	338	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.91e-73	5	342	2	338	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6UJE_A	6.92e-28	3	326	6	290	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
3AMC_A	5.70e-24	9	340	14	300	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3RJY_A	1.13e-23	10	339	23	314	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	2.00e-91	6	326	6	300	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P23340	4.01e-73	5	342	2	338	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	4.01e-73	5	342	2	338	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	1.13e-72	5	342	2	338	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P25472	8.25e-22	10	329	38	307	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002008_01500.