CAZyme Information: MGYG000002011_00583

Basic Information

• Species: HGM11575 sp900754775
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11575; HGM11575 sp900754775
• CAZyme ID: MGYG000002011_00583
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213	MGYG000002011_63|CGC1	24366.58	6.9849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002011	2206700	MAG	Spain	Europe

• Gene Location: Start: 6340; End: 6981 Strand: -

Full Sequence      

MTQRQRARQAGERAPLRRVRAARRRRQRRRTLLAIFASALIVLIALGAWALFGRDRIDLS
RYPMTYAPEIRAAAAEFSLDPAYVASVVLAESSFDAEAVSSVGAIGLMQIMPATGEWIAG
KLEDEPFDVQRLYQPEVNLRYGCWYLRFLLDRYDEDMYTASTAYHQGQGRVDQWLEDPQY
SQDGRTLTAISSAVTDTYVNRIMESYANYQELY

Enzyme Prediction     

No EC number prediction in MGYG000002011_00583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	80	210	3.2e-27	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.81e-64	63	206	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.39e-45	61	212	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.40e-33	81	207	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.60e-28	70	175	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.29e-27	60	213	133	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL76418.1	1.24e-39	39	213	20	191
QWT54455.1	7.55e-39	40	213	30	206
QEK13628.1	1.36e-38	62	213	18	169
AAM24132.1	1.48e-38	62	213	31	182
AFS78006.1	2.15e-38	35	213	12	188

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	6.92e-17	55	207	439	589	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	7.03e-17	55	207	468	618	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	1.73e-16	55	207	440	590	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.73e-16	55	207	439	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	5.74e-16	61	213	411	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	1.79e-14	62	207	1418	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.79e-14	62	207	1418	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O31608	5.58e-14	70	192	64	177	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P27380	4.82e-12	70	180	11	111	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P0AGC3	2.00e-09	61	210	475	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999850	0.000198	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
31	53