CAZyme Information: MGYG000002022_01732

Basic Information

• Species: Centipeda artemidis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Centipeda; Centipeda artemidis
• CAZyme ID: MGYG000002022_01732
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		59554.06	7.3732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002022	2160973	MAG	Spain	Europe

• Gene Location: Start: 1026; End: 2612 Strand: +

Full Sequence      

MNDDKTLAWPVYLLLLVVVSFQILYGIGAAPLLDPDEPVYAETAKEMIRFGDYLSPRIYN
EYWYDKPPIFYWMVAASFKIFGGFSETAARLPAALMAIGSVLMTALASARLFGARTGFWS
GIVMGTSVMLIYMGKASVTDTTLLFFMTAALFSFIHRHYWLMYLACGFAVMTKGPIGVVF
PGAIVFFYLLVTHRLEELLRMHVMRGLLLVVAVGLPWYGYMYALHGAAFFNEFIGFHNVS
RFTAPLHPVRAHWWFYLPVIILGFFPWTGLLVQSVRNAFYRSFGEEAQLLSFFQVWWIFV
LVFFSIAQTKQVSYMLILTPALSTIIAWNLARMMEDWRGTHFAWAGGSALMFLVLGLGWL
MSGDSMAELAEGGLWLGVLTLVLGAAIVYSITASHRLLLAAWLHAAAGVLTMILAFGVMI
PAVSGHFSVKELALRYAQEYRDSAEAEGRVLYIDKQLRPGVMLYTDIPGIEADTNRVESL
AALREDGRPKYIIMRDYMYQKMKKELGADHWTLVESRDGLSVYKDDRS

Enzyme Prediction     

No EC number prediction in MGYG000002022_01732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	439	2.7e-105	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.53e-51	24	357	22	363	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.30e-28	35	316	31	319	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	6.53e-15	65	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.59e-10	38	225	43	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOH48432.1	0.0	1	527	1	527
ANR70824.1	0.0	1	527	1	527
QNH53437.1	0.0	1	527	1	527
AME03144.1	4.77e-300	1	526	1	526
AKT54119.1	6.77e-300	1	526	1	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	6.30e-31	32	333	54	367	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.36e-32	12	327	5	318	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	1.59e-28	13	355	5	327	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A0KGY4	3.64e-27	21	347	14	350	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
C6DAW3	6.98e-27	17	361	13	374	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
A4SQX1	1.19e-26	31	347	24	350	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996702	0.003039	0.000033	0.000022	0.000015	0.000210

TMHMM  Annotations     

start	end
7	29
67	84
91	113
117	134
141	160
175	193
206	228
253	275
288	307
312	331
340	362
372	391
398	420