CAZyme Information: MGYG000002025_00239

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG12045
• CAZyme ID: MGYG000002025_00239
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000002025_3|CGC2	85164.93	4.9947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002025	2870501	MAG	Spain	Europe

• Gene Location: Start: 62311; End: 64518 Strand: +

Full Sequence      

MAKLRELTQKTVRTLREDGFQKVGEKAKIYLKRIREEKVGQEYTDRCFREVLFINGCDEH
LPHPGRYRVTHQREQLESLGITTGEVYYRYLKLDTVRCYRTFVFFRCPYTPVIGEFVEQA
HKLNKKVFYDVDDLVIDTAYTDMIAYLDTLSHQERQEYDQGVRDMGRLLRLCDGAVTTTG
CLAHELEQYVPKVLVNRNVASEEMVKLSLEAEGKAFKGEEEKAVVSLGYFSGSITHDEDF
QMILPVLLKLMEEYPNLRLHLAGELHLPPELEERKEQVQMQPFASWRELPAMIAGVDINL
APLTTTTFNRAKSENKWVEAALVKVPTVASDIGAFHEMVENGKTGILCQNLEQWEAALRA
LIEQPDYRTLIGEAAWEYCLDHCVTANTGQELGRFLKGQESKSAVFLLPAFQVSGGVMVA
LQHCRILQEAGWDVLLYSIEERGRERWYEFEGCRFPVLNGNDAAIYGDFDWAVATMWSTV
DWLEAFPRVKHRGYLVQNYEPGFYASGDPLRMRARKTYGYREDLQYLTISRWCQEWLMEQ
YGHEARYAPNGIAPEKFFPAPRNLEETSGEKIRILIEGDSTAPHKNVDESFRIVEKLDPE
RFEVWYMAYSGEPKDWYRVDRFLPKVPYDQIQEVYQDCDILLKSSLMESFSYPPLEMMAA
GGFVVAVLNGGNREYLEDKENCLCYRPGDLDQAVQAILRICGDRELQDKFYQNGHKTVME
RDWKQIKESILNLYQ

Enzyme Prediction     

No EC number prediction in MGYG000002025_00239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	621	709	7.3e-17	0.55

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.13e-35	406	735	4	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03794	GT4_WbuB-like	7.65e-26	120	387	119	385	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	2.07e-22	405	735	6	375	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	2.99e-19	51	382	2	351	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	2.01e-16	583	716	13	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO35979.1	6.80e-278	1	734	1	722
QBF76212.1	6.80e-278	1	734	1	722
SET96050.1	1.26e-246	5	735	4	729
BBF44263.1	2.94e-240	1	734	1	756
QIA33403.1	5.42e-237	14	734	11	757

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	1.66e-10	352	723	868	1242	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002025_00239.