CAZyme Information: MGYG000002025_00245

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG12045
• CAZyme ID: MGYG000002025_00245
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	MGYG000002025_3|CGC2	70629.28	6.608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002025	2870501	MAG	Spain	Europe

• Gene Location: Start: 68337; End: 70172 Strand: +

Full Sequence      

MAESKWISYVKKIRPYNIVKGVRYLKHFGFKEFMIRLSERMEPEEVPYGPWYENYRAKEP
KLEQQRKYRFKEPAVFSIVVPVYKTPELFLRQMIQSVLDQTYPHWELCIANGSPEDETVS
GVLLEYQEKDARIRIQNLENQGIAGNSNAALAMAEGDFIGLLDHDDLLAPDALFQVAKAL
EQRAGRRPMREAEADVIYTDEDKVTGDLTEHFQPHLKPDFNLDLLRSNNYICHFLVVRKS
LVEKTGGFRKEFDGAQDYDFIFRCVELAREVVHVPEILYHWRVHQSSTADNPASKLYAYE
AGQRAIQEHLRRQNTPGAVEKKKDLGFYRVVYPVRQEALISIVIPNKDHRELLQRCLTSV
YEKSTYGNYEILIVENNSTEKETFDYYKEIDGKRNTRVLYWKGEFNYSAINNFGISQAKG
EYLICLNNDIEVITPGWMEELLGTCQRPEVGIVGSRLYYPDNTIQHAGIVVGIGGIAGSM
FVGMKRERSGYLHKAALMQDLSAVTAACFMVKRSAYEAAGGFEEKLAVAFNDVDFCLKVC
QAGYLVVYDPYAELYHHESKTRGSEDTKEKVQRFQNEIEYMRSHWTDILKKGDPYYNKNL
SLSKWNYSLRS

Enzyme Prediction     

No EC number prediction in MGYG000002025_00245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	77	244	7.4e-23	0.9823529411764705
GT2	341	517	3.5e-20	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.38e-101	75	283	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	6.87e-40	342	558	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	7.51e-29	77	288	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.13e-25	340	591	5	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.02e-22	77	182	1	105	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10257.1	1.74e-312	1	611	1	603
CBL21583.1	1.16e-309	5	610	11	609
QCU01342.1	5.47e-308	5	610	11	609
AWY98933.1	1.69e-304	5	610	7	606
QIB58022.1	6.87e-299	1	610	1	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z87_A	1.14e-14	37	289	346	578	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	1.15e-14	37	289	347	579	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.96e-146	69	611	361	899	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.94e-102	37	610	278	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	2.28e-16	73	332	4	261	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q9CMP0	2.53e-16	77	289	436	637	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q7BLV3	2.54e-16	77	289	443	644	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002025_00245.