CAZyme Information: MGYG000002025_01190

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; RUG12045
• CAZyme ID: MGYG000002025_01190
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810		90090.82	5.977

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002025	2870501	MAG	Spain	Europe

• Gene Location: Start: 17951; End: 20383 Strand: +

Full Sequence      

MKYKELIDQMTLEEKAAFLGGKGEWMTWDFKRLGIPEMIMADGPSGVRRQSGAGDHLGLN
PSLPATCVPSAATMACSWDTALAERVGTLLGEEAMTENVQVLLGPGMNTKRSPLCGRNFE
YYSEDPYLAGKMAAGCIRGIQSQGVWACAKHFAVNSQEERRMAVNAVLDERTLRELYLTQ
FEIAVKQGGVKAVMTSYNQVNGTYANENPHLLREILREDWGFDGMVVTDWGGSNDHVAGV
KAGSDLEMPNPGLDSARILLKAIEEKRLTVEEVDERVDTLLDAVMTTTRAAKGHRETYDT
QEHHQIAREAAAQCGVLLKNEDGILPLKKGIRVAVIGDFAFQPRYQGAGSSLVNCTKLET
IEEEIKKERDIQVIGMCRGYQRQGEADEALLQEAVELAKQAEVVLYFFGLDEMSEVEGQD
RTHLRIHQNMVEVLCAMAKANPNIVGILSAGSAIEMNWDVHVKGLLQGYLMGQAGAGAML
DLLTGRVNPSGKLAETYPEKLEDTPAYRYCPAKERNTEHREGLFIGYRYYETADVPVRYP
FGYGLSYTTFSYENLKVTAEGVSFRIKNTGTADGAETAQLYVSLPETGVIRPKKELKGFA
KVFLKAGESKTVTIPFDEMTFRYWNAKKNGWAVEGGTYEIQIGASLEDIRLRESLQVKGS
GEESPYERETLPAYFSGKITNVSDREFEALLGHRIPDGSWKHILTANDTICQLKNAKLWF
ARMVYRVIEGKRKKAEAAGKPDLNILFIYNMPFRAIAKMTEGMVSMEMVEGMVEAVNGHF
FRGLGKVIRGYFRNGKENKAFQKKIKGEEA

Enzyme Prediction     

No EC number prediction in MGYG000002025_01190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	249	1.3e-69	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.73e-81	66	643	118	751	beta-glucosidase BglX.
COG1472	BglX	4.30e-70	32	340	57	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.20e-50	6	617	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.62e-49	316	547	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.22e-37	32	281	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL34828.1	0.0	1	806	1	805
AOZ95741.1	0.0	1	806	1	805
QBE98345.1	0.0	1	805	1	804
QQR02742.1	0.0	1	809	1	812
ANU50590.1	0.0	1	809	1	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.03e-211	4	777	6	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.82e-179	7	665	9	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.13e-126	2	663	3	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.08e-124	2	663	3	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	5.64e-106	4	649	7	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.56e-211	4	777	6	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.75e-174	7	665	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.54e-172	7	665	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	8.27e-129	1	650	44	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	5.94e-121	4	649	12	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002025_01190.