CAZyme Information: MGYG000002031_01711

Basic Information

• Species: UBA5905 sp900549155
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp900549155
• CAZyme ID: MGYG000002031_01711
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193		22319.56	8.5714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002031	2138143	MAG	Spain	Europe

• Gene Location: Start: 6161; End: 6742 Strand: +

Full Sequence      

MKQKRTRHVLRLTAIVLLILCGIGALLFNGYRRYMRTEYPLAYTELIEKYSAEYDITPSL
ICAVICVESHYKPEAVSHAGAVGLMQLTPDTFDWAQRRAGIKEKQDAKALTDPETNIRFG
TYTLRLLYEQFEDEDAVLAAYNAGQGNVRRWLSDSRYSDDGVHLKKIPYAETETYVRRIE
KAQSVYQKLYHIR

Enzyme Prediction     

No EC number prediction in MGYG000002031_01711.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	183	5.6e-29	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.39e-68	40	185	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.90e-45	39	189	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.16e-34	58	179	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	2.11e-33	45	184	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11619	PRK11619	5.98e-29	39	179	475	617	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCN93454.1	8.72e-50	10	190	7	189
AYF42704.1	8.72e-50	10	190	7	189
AYF39872.1	8.72e-50	10	190	7	189
AVQ97208.1	8.72e-50	10	190	7	189
ADU28212.1	8.72e-50	10	190	7	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	7.47e-23	34	187	444	599	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.02e-22	34	187	444	599	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6FBT_A	1.91e-18	38	189	444	596	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.94e-18	38	189	473	625	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	4.81e-18	38	189	444	596	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	1.65e-22	34	187	471	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	4.16e-22	34	187	471	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	4.16e-22	34	187	471	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
B3GYW8	5.41e-14	43	193	197	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1
B0BSH0	5.41e-14	43	193	197	365	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.927271	0.060332	0.003769	0.000606	0.000289	0.007735

TMHMM  Annotations     

start	end
9	31