CAZyme Information: MGYG000002033_01337

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_01337
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929	MGYG000002033_11|CGC2	105243.39	5.5022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 73325; End: 76114 Strand: -

Full Sequence      

MRRINIYLLLTALLMCMFSCKNDLSHISLAGEWEFALDSTDTGIKENWAEHNLKNTIQLP
GTTDDAGYGTPNKLAPAIHKPQVLHLTRKNSYVGPAWYSKEVDIPSSWKDKEIELKLERV
IWQTAVWVDGKQVEGMQESLVAPHLYDLTGQLTPGKHKITIRVDNRKRYDITAGDMAHAY
TNETQIMWNGIIGEIALTAKDALSIRNLQAYPDYKNKQVKIRCQINNSGTVTTGTLTADI
KATTDPATQIQQRVTLQPGENLIDLVCPVKDDIQTWNEFSPTLYTLRASIETDPYKDSRE
IKFGFRDLEKKGPALLLNDRKIFLRGTLECCIFPLTGYPPMQHEGWEKVFSTAREWGLNH
LRFHSWCPPKAAFEVADSLGFYLQVELPLWSTNLCNDKRAPYLYAEADRILEEYGNHPSF
CLLSLGNELQYDFEFLGSLLNHVKEKDPRHLYTTTSFTFEKGHGNWPEANDDFFITQWTK
KGWVRGQGVFNTESPRFDKDYSASVEGMDVPLVTHEIGQYAVYPDLKEIEKYTGVLDPLN
FKGVKEDLEKKGLADKADDYLMATGKLAALLYKEEIERAMRTPGISGFQLLDLHDFPGQG
TALVGLLNAFWESKGVTEAASFRQSCAPVTPLARFSKATYTSDEPFEATIEVVNYSDKAI
ENAVIDWKLTDRNGQTVAQGEFPTCSLPVGENSPAGNIRCQLNQITEAKELTLSATLKGS
DYTNEWKIWVYPASLTINKGDIIITDRFATAEKALQEGKKVLFNPPYESLKGLEGKFVPV
FWSPVHFPKQAGTMGLLLDPNHPAFAHFPTDSHTDWQWWRLTTQSKTLCIDSLYTEITPL
IECVDNFANNRRLTNLFETNCLNGKLVICSMDLLREQEKNPEKRQLLYSIIEYMKSDEFN
PSQQTSPATISTFLTSGQRSLKEKTDSIY

Enzyme Prediction     

No EC number prediction in MGYG000002033_01337.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	25	717	1.8e-71	0.7207446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.71e-22	27	462	13	442	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	1.33e-16	28	165	3	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK10150	PRK10150	4.11e-14	28	171	14	142	beta-D-glucuronidase; Provisional
PRK10340	ebgA	3.72e-09	98	451	113	471	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	2.66e-06	205	306	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOG04937.1	0.0	9	929	4	929
APA00996.1	0.0	7	929	5	931
QKH84659.1	0.0	19	902	16	901
QCQ54210.1	0.0	19	902	16	901
QRM70214.1	0.0	19	902	16	901

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	3.31e-23	27	451	39	462	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.32e-23	27	451	40	463	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6D1N_A	4.70e-16	28	447	38	443	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]
6D89_A	8.04e-16	92	447	97	435	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
3GM8_A	2.49e-15	28	429	1	397	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.82e-22	27	451	40	463	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KPJ7	3.72e-13	40	486	52	492	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q48846	6.79e-13	98	451	133	487	Beta-galactosidase large subunit OS=Latilactobacillus sakei OX=1599 GN=lacL PE=3 SV=1
Q04F24	7.24e-13	28	447	49	475	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
Q03WL0	1.25e-12	28	448	47	475	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000320	0.169439	0.830015	0.000069	0.000081	0.000076

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_01337.