CAZyme Information: MGYG000002033_01812

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_01812
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	MGYG000002033_17|CGC1	88666.36	6.7883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 27686; End: 30037 Strand: -

Full Sequence      

MKTYFIPILLACAFFAAIFPLQAQQSIYVAPTGNDRNAGTKDAPLASLPAAIKTIETSTE
QNITLFLQKGTYHLEKPLTFSPEILAGKRLQITTSTQSDSVIISGNKRLSLQWKKGKHGL
WEAQTEDSFDQLWINGSPRILARYPNYRKDTLFNGTAEDALSPERIKKWKNPEGGYIHSM
HAGMWGSQHYLITGKVKDSLIYEGGYQVSRPSKIHPSLRYVENIREELDSPGEWFLDKKK
HILYYYPLPGETMDAVEAEATVTPHLFVIRGTENEPVRGISINGITFTHTRRTVMEPYEM
LMRSDWGIYRGAAVLFENTENCKINNCEFKEIGGNAVFLSRYAYQDTVIGNHIHHTGGSA
ICIVGDTSATRSGAYGYSHFIPFEQMDRTPGPKNKLYPRQCLVEDNLIHDLGTVEKQVAG
VEIQIAAMLTIRYNTIYDVPRAGINVGDGAFGGHLIEYNDVFDTVLETSDHGAFNSWGRD
RFWHPKYNEMARLAEEHPELTGADALYTNILRYNRFRCDHGWDIDLDDGSSNYHIYNNIC
LRGGIKLREGFLRKVENNILVNNSLHPHVWFKNSHDVVRRNLFMQPYYPISLNGWGEQLD
YNFFTSQMALDNVRKNQTDAHSITGAFDFEDAARGNYTLLPGSKVFEIGFENIPMDRFGV
YSQRLKALAKTPEFPLIQIIDAYDQDKTYSWLGATIRIVNGLGDRSAFGLPDERGIVIIA
VEKGSLADKAGLGRNDVIRAIAGKEISTIEEVFALTEENRWKGKVFVTIIRNQTEEKTQL
KFK

Enzyme Prediction     

No EC number prediction in MGYG000002033_01812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	26	540	7e-67	0.9886148007590133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00987	PDZ_serine_protease	2.99e-15	691	772	2	82	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
pfam17820	PDZ_6	5.02e-08	717	771	1	54	PDZ domain. This entry represents the PDZ domain from a wide variety of proteins.
cd00989	PDZ_metalloprotease	1.04e-07	717	782	15	79	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
cd00991	PDZ_archaeal_metalloprotease	1.23e-07	715	775	11	71	PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
pfam13229	Beta_helix	1.40e-07	312	463	1	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	5.22e-207	12	767	15	784
BAU63437.1	1.99e-52	28	564	58	596
AFZ35556.1	3.84e-46	28	660	49	710
QGA25764.1	2.39e-36	1	661	1	663
AKP49975.1	2.08e-35	25	686	36	706

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	2.67e-19	21	299	21	334	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000397	0.998778	0.000322	0.000174	0.000156	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_01812.