CAZyme Information: MGYG000002033_02074

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_02074
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43063.83	8.7165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 8880; End: 10013 Strand: +

Full Sequence      

MKYFLIAGEASGDLHASNLMAALKKQDAEADFRFLGGDLMQAVGGTLVKHYRDMAFMGFI
PVLLNLRTILNNMKACQEEIRKYRPDVVILIDYPGFNLKIAKYVKTQLGLPVYYYISPKI
WAWKQYRIKDFRRYVDRMFCILPFEVEFFHKLDYPVDYVGNPSVDSVAGYMEKQAAVPDT
FRADEQLDERPVLALLAGSRRQEIKDNLPTMLKVAAAYPDYQPVIAGAPGLEPEYYRQYI
GDADVRIVFGKTYPLLSHSDAALVTSGTATLETSLFRVPQVVCYYVAAGRLASFIFRHFF
HTKYISLVNLIAGREVVQELFGARFSYGHIHDELGRVLNDPAYRNRMLDGYDEMIRLLGK
PGASRRTAELIYQSLKY

Enzyme Prediction     

No EC number prediction in MGYG000002033_02074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	1.1e-112	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.92e-115	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.28e-97	1	376	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.36e-75	4	366	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.74e-65	5	369	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.79e-47	1	311	2	286	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50508.1	2.73e-264	1	377	1	377
ABR44355.1	3.52e-228	1	375	1	375
QRO15504.1	3.52e-228	1	375	1	375
BBK92630.1	3.52e-228	1	375	1	375
QCY57761.1	3.52e-228	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.59e-39	5	320	11	327	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.59e-39	5	320	11	327	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.26e-71	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	1.38e-65	5	376	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	3.70e-62	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2IL69	5.53e-61	2	369	10	376	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q74AT9	3.13e-60	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_02074.